Project name: 7AP7

Chain sequence(s)	A: KVFERCELARRTLKRLGMMDGYRRGISLANWMCCLAKWESGYNTRATNYNAGDRSTDYGIFQIINSRYRCNDGKTPGAVNACHHLSCSALLQDNIADAVACAKRVVRDPQGIRRAWVAWRNRCCQNRDVRQYVQGCGV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:59)

• Minimal score value: -4.2589
• Maximal score value: 1.2409
• Average score: -1.0682
• Total score value: -138.8646

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-2.2290
2	V	A	-0.2870
3	F	A	0.0000
4	E	A	-2.1650
5	R	A	-1.8550
6	C	A	-1.5821
7	E	A	-1.9617
8	L	A	0.0000
9	A	A	0.0000
10	R	A	-2.2319
11	T	A	-1.7767
12	L	A	0.0000
13	K	A	-2.5376
14	R	A	-2.5691
15	L	A	-1.2653
16	G	A	-1.4126
17	M	A	0.0000
18	D	A	-2.2365
19	G	A	-1.7906
20	Y	A	-1.7517
21	R	A	-2.6617
22	G	A	-1.6872
23	I	A	0.0000
24	S	A	-1.2772
25	L	A	0.0000
26	A	A	0.0000
27	N	A	-1.2413
28	W	A	0.0000
29	M	A	0.0000
30	C	A	0.0000
31	L	A	0.0000
32	A	A	0.0000
33	K	A	-0.8636
34	W	A	-0.3298
35	E	A	-0.5883
36	S	A	-0.5791
37	G	A	-0.4218
38	Y	A	-0.7226
39	N	A	-1.2790
40	T	A	0.0000
41	R	A	-2.3788
42	A	A	-1.2442
43	T	A	-0.7843
44	N	A	-0.4083
45	Y	A	0.1665
46	N	A	-0.8204
47	A	A	-0.9083
48	G	A	-1.2392
49	D	A	-1.8927
50	R	A	-2.5049
51	S	A	0.0000
52	T	A	0.0000
53	D	A	-0.5044
54	Y	A	0.0000
55	G	A	0.0000
56	I	A	0.0000
57	F	A	0.0000
58	Q	A	-0.6558
59	I	A	0.0000
60	N	A	-0.4068
61	S	A	0.0000
62	R	A	-0.6474
63	Y	A	1.1235
64	R	A	-0.2424
65	C	A	0.0000
66	N	A	-1.7643
67	D	A	-1.9339
68	G	A	-1.9051
69	K	A	-2.6504
70	T	A	0.0000
71	P	A	-1.3028
72	G	A	-0.5340
73	A	A	0.0222
74	V	A	1.2409
75	N	A	-0.4260
76	A	A	-0.3157
77	C	A	-0.8525
78	H	A	-1.2904
79	L	A	-0.9785
80	S	A	-1.0829
81	C	A	0.0000
82	S	A	-0.6994
83	A	A	-0.8524
84	L	A	0.0000
85	L	A	-1.7387
86	Q	A	-2.6504
87	D	A	-3.2556
88	N	A	-2.6579
89	I	A	0.0000
90	A	A	-0.9073
91	D	A	-0.9714
92	A	A	0.0000
93	V	A	0.0000
94	A	A	-0.5826
95	C	A	0.0000
96	A	A	0.0000
97	K	A	-1.9613
98	R	A	-2.6040
99	V	A	0.0000
100	V	A	0.0000
101	R	A	-3.8218
102	D	A	-3.5169
103	P	A	-2.1446
104	Q	A	-2.1315
105	G	A	-2.5443
106	I	A	0.0000
107	R	A	-1.7794
108	A	A	-0.9795
109	W	A	0.0000
110	V	A	0.5493
111	A	A	-0.5938
112	W	A	0.0000
113	R	A	-2.7467
114	N	A	-2.7927
115	R	A	-2.7193
116	C	A	0.0000
117	Q	A	-3.3064
118	N	A	-3.3300
119	R	A	-4.2589
120	D	A	-3.8075
121	V	A	0.0000
122	R	A	-3.4675
123	Q	A	-2.7459
124	Y	A	-1.7581
125	V	A	-1.4056
126	Q	A	-2.1647
127	G	A	-1.3395
128	C	A	0.0000
129	G	A	-0.4816
130	V	A	-0.2720