Project name: 6fac6f0614d0c4

Status: done

Started: 2026-07-01 15:24:50
Settings
Chain sequence(s) B: APTSVTFVWMSRGPLEKTPQRVATSTVVGAGLQAVSISVSGGVLTVTLRL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:14)
Show buried residues

Minimal score value
-2.5069
Maximal score value
2.6997
Average score
0.3121
Total score value
15.6047

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B 0.0780
2 P B 0.2117
3 T B 0.3993
4 S B 0.8672
5 V B 1.0623
6 T B 0.7135
7 F B 0.8346
8 V B 1.0096
9 W B 0.9798
10 M B 0.1330
11 S B -1.1079
12 R B -2.5069
13 G B -1.3581
14 P B -0.4057
15 L B 0.3834
16 E B -1.5293
17 K B -2.1883
18 T B -1.8355
19 P B -2.0376
20 Q B -2.2506
21 R B -1.3474
22 V B 0.7962
23 A B 0.6615
24 T B 0.4441
25 S B 0.5001
26 T B 0.7169
27 V B 1.5084
28 V B 2.0114
29 G B 0.9611
30 A B 0.3106
31 G B -0.1954
32 L B 0.0762
33 Q B -1.1931
34 A B -0.0619
35 V B 0.4609
36 S B 0.8083
37 I B 2.6379
38 S B 2.1476
39 V B 2.6997
40 S B 1.0105
41 G B 0.2388
42 G B 0.6863
43 V B 2.2545
44 L B 2.6260
45 T B 1.8882
46 V B 1.6320
47 T B 0.5123
48 L B -0.0644
49 R B -1.2357
50 L B 0.6606
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018