Project name: 6fc11a53ecb474e

Chain sequence(s)	A: HNTTVVQGVEGQTLVVECPYDAVKHWGRRKAWCRQLGENGPCQRVVSTHNDWLLSFLTRWNGSTSIQDDTLGGTLTITLRNLQPHDAGLYQCQSLSGDEADTLRKVLVEVLAD
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)

• Minimal score value: -3.0653
• Maximal score value: 2.2085
• Average score: -0.6411
• Total score value: -72.4444

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	H	A	-1.8298
2	N	A	-1.7955
3	T	A	-0.6202
4	T	A	0.3784
5	V	A	1.4674
6	V	A	0.5267
7	Q	A	-0.3928
8	G	A	-0.6772
9	V	A	-0.8256
10	E	A	-2.1405
11	G	A	-2.1231
12	Q	A	-2.1755
13	T	A	-1.2838
14	L	A	0.0000
15	V	A	0.9100
16	V	A	0.0000
17	E	A	-1.5710
18	C	A	0.0000
19	P	A	-1.1334
20	Y	A	-0.7424
21	D	A	-0.5717
22	A	A	0.2125
23	V	A	1.1605
24	K	A	-0.9376
25	H	A	-0.4520
26	W	A	0.8315
27	G	A	-0.0192
28	R	A	-0.7966
29	R	A	-0.7662
30	K	A	0.0000
31	A	A	0.0000
32	W	A	0.0000
33	C	A	0.0000
34	R	A	-1.3622
35	Q	A	0.0000
36	L	A	-0.4549
37	G	A	-1.4548
38	E	A	-2.5048
39	N	A	-2.2547
40	G	A	-1.4888
41	P	A	-1.2444
42	C	A	-1.4294
43	Q	A	-2.0957
44	R	A	-2.4048
45	V	A	-1.1422
46	V	A	0.0000
47	S	A	-0.8886
48	T	A	0.0000
49	H	A	-0.5603
50	N	A	-1.6019
51	D	A	-1.0494
52	W	A	0.3645
53	L	A	1.6593
54	L	A	1.5440
55	S	A	0.0000
56	F	A	2.2085
57	L	A	1.5669
58	T	A	0.4422
59	R	A	-0.5223
60	W	A	-0.1978
61	N	A	-1.1733
62	G	A	-1.1761
63	S	A	-1.4097
64	T	A	-0.8476
65	S	A	0.0000
66	I	A	0.0000
67	Q	A	-0.2539
68	D	A	0.0000
69	D	A	-0.6563
70	T	A	0.6808
71	L	A	1.3615
72	G	A	-0.1496
73	G	A	0.0000
74	T	A	-1.1164
75	L	A	0.0000
76	T	A	-0.6214
77	I	A	0.0000
78	T	A	-0.1411
79	L	A	0.0000
80	R	A	-2.6860
81	N	A	-2.8827
82	L	A	0.0000
83	Q	A	-2.1230
84	P	A	-1.1983
85	H	A	-1.6723
86	D	A	-1.5954
87	A	A	-0.9182
88	G	A	-0.3488
89	L	A	-0.0497
90	Y	A	0.0000
91	Q	A	-0.9515
92	C	A	0.0000
93	Q	A	0.0000
94	S	A	0.0000
95	L	A	-1.4344
96	S	A	-1.8101
97	G	A	-2.0190
98	D	A	-2.8865
99	E	A	-3.0653
100	A	A	-1.8776
101	D	A	-1.5576
102	T	A	-1.0977
103	L	A	-0.9618
104	R	A	-1.6053
105	K	A	-0.9366
106	V	A	0.0000
107	L	A	0.6457
108	V	A	0.0000
109	E	A	-0.5656
110	V	A	-0.7094
111	L	A	-0.0153
112	A	A	-0.6460
113	D	A	-1.7342