Project name: 6fff77580cf00cd

Chain sequence(s)	A: KAGTCPDGYTRTNYYCRRDGCGSWCNGAERQQPCIRGPCCCDLTYRTG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)

• Minimal score value: -3.4723
• Maximal score value: 0.5323
• Average score: -1.2086
• Total score value: -58.0122

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-1.7939
2	A	A	-0.9291
3	G	A	-0.7425
4	T	A	-0.4297
5	C	A	-0.1276
6	P	A	-0.9548
7	D	A	-1.9776
8	G	A	-1.2143
9	Y	A	-0.7637
10	T	A	-0.9445
11	R	A	-1.8542
12	T	A	-0.9762
13	N	A	-0.7285
14	Y	A	-0.0620
15	Y	A	0.1826
16	C	A	-0.2572
17	R	A	-2.2465
18	R	A	-3.4723
19	D	A	-3.1922
20	G	A	-1.9965
21	C	A	-1.1928
22	G	A	-0.6328
23	S	A	-0.1855
24	W	A	0.5323
25	C	A	-0.7827
26	N	A	-1.5925
27	G	A	-1.4186
28	A	A	-1.7720
29	E	A	-3.1129
30	R	A	-3.1143
31	Q	A	-2.0017
32	Q	A	-2.2356
33	P	A	-1.1778
34	C	A	-0.4621
35	I	A	-0.2218
36	R	A	-1.8879
37	G	A	-2.0945
38	P	A	-2.1793
39	C	A	-2.0253
40	C	A	0.0000
41	C	A	0.0000
42	D	A	0.0000
43	L	A	-0.9757
44	T	A	-1.0212
45	Y	A	-0.2908
46	R	A	-1.6550
47	T	A	-1.0174
48	G	A	-1.0136