Project name: scan

Status: done

Started: 2026-05-10 14:32:05
Settings
Chain sequence(s) A: GQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)
Show buried residues

Minimal score value
-3.7112
Maximal score value
1.1989
Average score
-1.0846
Total score value
-138.831

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
14 G A -1.1684
15 Q A -1.2886
16 V A -0.8633
17 R A -2.5166
18 Q A -2.0277
19 R A -1.2408
20 Y A -0.4395
21 L A 0.0000
22 Y A -0.6942
23 T A 0.0000
24 D A -2.4437
25 D A -3.2595
26 A A 0.0000
27 Q A -3.2139
28 Q A -2.8082
29 T A -2.3544
30 E A -3.3758
31 A A -2.4144
32 H A -1.4689
33 L A 0.0000
34 E A -1.0979
35 I A 0.0000
36 R A -2.6084
37 E A -3.5025
38 D A -2.9428
39 G A 0.0000
40 T A -1.1510
41 V A 0.0000
42 G A 0.0000
43 G A -1.0596
44 A A -1.3412
45 A A -1.5614
46 D A -2.8078
47 Q A -2.3647
48 S A -1.5532
49 P A -1.1008
50 E A -1.4189
51 S A 0.0000
52 L A -0.6624
53 L A 0.0000
54 Q A -0.6928
55 L A -1.0094
56 K A -1.1753
57 A A -0.8931
58 L A -0.5118
59 K A -1.8034
60 P A -1.3151
61 G A -1.4783
62 V A 0.0000
63 I A 0.0000
64 Q A 0.0000
65 I A 0.0000
66 L A 0.3351
67 G A 0.0000
68 V A -0.1247
69 K A -1.8268
70 T A -1.5323
71 S A -0.4669
72 R A -0.2601
73 F A 0.7696
74 L A 0.0000
75 C A 0.0000
76 Q A 0.0000
77 R A -1.9482
78 P A -2.0235
79 D A -2.2463
80 G A 0.0000
81 A A -0.9077
82 L A 0.0000
83 Y A -0.0629
84 G A 0.0000
85 S A 0.2690
86 L A 1.1989
87 H A 0.1410
88 F A 0.4352
89 D A -1.2932
90 P A -1.4632
91 E A -2.7004
92 A A -1.7630
93 C A 0.0000
94 S A 0.0000
95 F A 0.0000
96 R A -2.3587
97 E A -1.3136
98 L A 0.1912
99 L A 0.9160
100 L A -0.3020
101 E A -2.0790
102 D A -2.3359
103 G A -1.1653
104 Y A -0.2674
105 N A 0.0480
106 V A 0.0000
107 Y A 0.0000
108 Q A -1.3262
109 S A 0.0000
110 E A -2.6314
111 A A -1.9894
112 H A -1.7784
113 G A -1.3756
114 L A -1.2158
115 P A -0.9706
116 L A 0.0000
117 H A -0.5675
118 L A -0.2600
119 P A -0.7372
120 G A -1.4519
121 N A -1.7837
122 K A -3.2090
123 S A -2.2385
124 P A -2.5264
125 H A -2.8147
126 R A -3.6343
127 D A -3.7112
128 P A -2.3251
129 A A -1.2847
130 P A -1.5500
131 R A -2.4513
132 G A -1.6221
133 P A -1.0389
134 A A -1.2856
135 R A -1.2699
136 F A 0.0000
137 L A 0.2516
138 P A 0.0546
139 L A 0.0160
140 P A -0.9570
141 G A -1.3800
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018