Project name: Nb_B

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASGLPEPSIAVYSLGWFRQAPGQGLEAVAAIDNTGKKTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAGYNPGEPATEPEDYDYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:07)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:07)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)

• Minimal score value: -3.1989
• Maximal score value: 1.6955
• Average score: -0.7416
• Total score value: -94.9271

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.5029
2	V	A	-0.9399
3	Q	A	-0.9680
4	L	A	0.0000
5	V	A	1.1184
6	E	A	0.3171
7	S	A	-0.1820
8	G	A	-0.6922
9	G	A	0.0912
10	G	A	0.6719
11	L	A	1.3888
12	V	A	-0.1121
13	Q	A	-1.4489
14	P	A	-1.8165
15	G	A	-1.5401
16	G	A	-1.0139
17	S	A	-1.2738
18	L	A	-0.8536
19	R	A	-2.0636
20	L	A	0.0000
21	S	A	-0.4067
22	C	A	0.0000
23	A	A	-0.0983
24	A	A	0.0000
25	S	A	-0.9975
26	G	A	-1.2836
27	L	A	-0.9334
28	P	A	-0.9032
29	E	A	-1.0980
30	P	A	-0.9201
31	S	A	-1.0467
32	I	A	0.0000
33	A	A	-0.4832
34	V	A	0.2469
35	Y	A	0.0000
36	S	A	0.0000
37	L	A	0.0000
38	G	A	0.0000
39	W	A	0.0000
40	F	A	0.0000
41	R	A	0.0000
42	Q	A	-0.7120
43	A	A	-0.9759
44	P	A	-0.9823
45	G	A	-1.2749
46	Q	A	-1.8158
47	G	A	-1.1651
48	L	A	-0.4787
49	E	A	-1.0429
50	A	A	-0.5690
51	V	A	0.0000
52	A	A	0.0000
53	A	A	0.0000
54	I	A	0.0000
55	D	A	0.0000
56	N	A	-1.0262
57	T	A	-1.4170
58	G	A	-2.0146
59	K	A	-2.8648
60	K	A	-2.8549
61	T	A	-1.3238
62	Y	A	-0.5919
63	Y	A	-0.7561
64	A	A	-1.3715
65	D	A	-2.4537
66	S	A	-1.7844
67	V	A	0.0000
68	K	A	-2.5761
69	G	A	-1.7668
70	R	A	-1.5505
71	F	A	0.0000
72	T	A	-0.8037
73	I	A	0.0000
74	S	A	-0.6009
75	R	A	-1.1564
76	D	A	-1.8425
77	N	A	-1.9055
78	S	A	-1.7238
79	K	A	-2.4408
80	N	A	-1.7445
81	T	A	0.0000
82	L	A	0.0000
83	Y	A	-0.6521
84	L	A	0.0000
85	Q	A	-1.2167
86	M	A	0.0000
87	N	A	-1.5282
88	S	A	-1.4381
89	L	A	0.0000
90	R	A	-2.9255
91	A	A	-2.0331
92	E	A	-2.4614
93	D	A	0.0000
94	T	A	-0.5122
95	A	A	0.0000
96	V	A	0.8005
97	Y	A	0.0000
98	Y	A	0.3679
99	C	A	0.0000
100	A	A	0.0000
101	A	A	0.0000
102	G	A	0.0000
103	Y	A	0.6930
104	N	A	-0.4200
105	P	A	-0.6696
106	G	A	-1.6798
107	E	A	-2.6896
108	P	A	0.0000
109	A	A	0.0000
110	T	A	-1.5860
111	E	A	-2.7299
112	P	A	-2.2349
113	E	A	-3.1989
114	D	A	-2.5364
115	Y	A	0.0000
116	D	A	-1.8980
117	Y	A	-0.5054
118	W	A	-0.0312
119	G	A	-0.0519
120	Q	A	-0.8481
121	G	A	0.0851
122	T	A	0.6100
123	L	A	1.6955
124	V	A	0.0000
125	T	A	0.3019
126	V	A	0.0000
127	S	A	-0.7956
128	S	A	-0.5075