Project name: 709dfd921c509a

Chain sequence(s)	A: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)

• Minimal score value: -3.2907
• Maximal score value: 0.8202
• Average score: -1.044
• Total score value: -40.7141

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	H	A	-1.1966
2	G	A	-1.1785
3	E	A	-1.8610
4	G	A	-1.2665
5	T	A	-0.5224
6	F	A	0.5997
7	T	A	-0.3041
8	S	A	-0.9701
9	D	A	-1.6976
10	L	A	-0.0718
11	S	A	-1.4280
12	K	A	-3.1995
13	Q	A	-2.5921
14	M	A	-1.8401
15	E	A	-3.2907
16	E	A	-3.1109
17	E	A	-2.2214
18	A	A	-1.0995
19	V	A	-0.1892
20	R	A	-1.4146
21	L	A	-0.0821
22	F	A	0.8202
23	I	A	0.2842
24	E	A	-1.5291
25	W	A	-0.6575
26	L	A	-0.4560
27	K	A	-2.0290
28	N	A	-2.1805
29	G	A	-1.4102
30	G	A	0.0000
31	P	A	-0.6433
32	S	A	-0.6858
33	S	A	-1.0226
34	G	A	-0.8971
35	A	A	-0.6745
36	P	A	-0.5901
37	P	A	-0.1465
38	P	A	0.0276
39	S	A	0.0131