Project name: 70ba38a98d7cf7e

Chain sequence(s)	A: MQVQLVESGGGSVQAGGSLRLSCTASGTKELKYAAFDLGWFRQAPGQEREAVAAIDRDGGITYYADSVKGRFTISRDNAKNTVTLQMNNLKPVDTAIYYCAARRSRNRTYESWGQGTQVTVSGGGGSHHHHHHLEVSGWRLFKKIS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:10)

• Minimal score value: -3.9834
• Maximal score value: 1.5705
• Average score: -0.9315
• Total score value: -136.0054

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.1287
2	Q	A	-1.2155
3	V	A	0.0000
4	Q	A	-1.2535
5	L	A	0.0000
6	V	A	0.4196
7	E	A	-0.3301
8	S	A	-0.7251
9	G	A	-1.3366
10	G	A	-1.2703
11	G	A	-0.9543
12	S	A	-0.7566
13	V	A	-0.8879
14	Q	A	-1.9390
15	A	A	-1.7583
16	G	A	-1.9787
17	G	A	-1.4511
18	S	A	-1.5602
19	L	A	-1.4373
20	R	A	-2.2324
21	L	A	0.0000
22	S	A	-0.6536
23	C	A	0.0000
24	T	A	-0.3898
25	A	A	0.0000
26	S	A	-0.7082
27	G	A	-0.8960
28	T	A	-0.5102
29	K	A	-0.7746
30	E	A	0.0000
31	L	A	0.0596
32	K	A	-1.4162
33	Y	A	0.0000
34	A	A	-1.4562
35	A	A	-1.5965
36	F	A	0.0000
37	D	A	0.0000
38	L	A	0.0000
39	G	A	0.0000
40	W	A	0.0000
41	F	A	-0.7424
42	R	A	-1.7669
43	Q	A	-2.5228
44	A	A	-1.5438
45	P	A	-1.3259
46	G	A	-1.8123
47	Q	A	-3.1875
48	E	A	-3.9834
49	R	A	-3.8760
50	E	A	-3.3348
51	A	A	-1.4422
52	V	A	0.0000
53	A	A	0.0000
54	A	A	0.5466
55	I	A	0.0000
56	D	A	0.0000
57	R	A	-2.2408
58	D	A	-2.5567
59	G	A	-1.4860
60	G	A	-0.5548
61	I	A	1.0699
62	T	A	1.0293
63	Y	A	0.8173
64	Y	A	-0.3828
65	A	A	-1.3108
66	D	A	-2.4138
67	S	A	-1.4266
68	V	A	0.0000
69	K	A	-2.5052
70	G	A	-1.9015
71	R	A	-1.8446
72	F	A	0.0000
73	T	A	-0.7872
74	I	A	0.0000
75	S	A	-0.4867
76	R	A	-1.6557
77	D	A	-2.0613
78	N	A	-2.6035
79	A	A	-1.4090
80	K	A	-2.1842
81	N	A	-1.5794
82	T	A	-1.1173
83	V	A	0.0000
84	T	A	-0.8053
85	L	A	0.0000
86	Q	A	-1.3534
87	M	A	0.0000
88	N	A	-1.9991
89	N	A	-2.3788
90	L	A	0.0000
91	K	A	-1.6629
92	P	A	-0.3636
93	V	A	1.2210
94	D	A	0.0000
95	T	A	-0.0236
96	A	A	0.0000
97	I	A	-0.5740
98	Y	A	0.0000
99	Y	A	-0.4438
100	C	A	0.0000
101	A	A	0.0000
102	A	A	0.0000
103	R	A	-2.1686
104	R	A	-3.2713
105	S	A	-2.4860
106	R	A	-3.0580
107	N	A	-2.9800
108	R	A	-2.9262
109	T	A	-1.8223
110	Y	A	-1.1274
111	E	A	-1.4901
112	S	A	0.0000
113	W	A	-0.1239
114	G	A	-0.3619
115	Q	A	-1.1171
116	G	A	-0.6763
117	T	A	0.0000
118	Q	A	-1.4522
119	V	A	0.0000
120	T	A	-0.5782
121	V	A	0.0000
122	S	A	-1.2178
123	G	A	-1.6153
124	G	A	-1.5374
125	G	A	-1.2811
126	G	A	-1.5422
127	S	A	-1.4428
128	H	A	-2.1817
129	H	A	-2.5621
130	H	A	-2.6576
131	H	A	-2.4828
132	H	A	-2.1948
133	H	A	-1.4553
134	L	A	0.1573
135	E	A	-0.6457
136	V	A	1.1662
137	S	A	0.3024
138	G	A	0.1310
139	W	A	0.9675
140	R	A	-0.3123
141	L	A	1.5705
142	F	A	1.2365
143	K	A	-0.9876
144	K	A	-1.1203
145	I	A	0.8669
146	S	A	0.3192