| Chain sequence(s) |
A: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | No |
| Mutated residues | FA20A |
| Energy difference between WT (input) and mutated protein (by FoldX) | 1.05807 kcal/mol
CAUTION: Your mutation/s can destabilize the protein structure |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:01)
[INFO] FoldX: Building mutant model (00:00:16)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:19)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:00:26)
[INFO] Main: Simulation completed successfully. (00:00:27)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 11 | E | A | -1.1922 | |
| 12 | V | A | 0.3727 | |
| 13 | H | A | -1.2791 | |
| 14 | H | A | -1.6693 | |
| 15 | Q | A | -2.0342 | |
| 16 | K | A | -1.3296 | |
| 17 | L | A | 1.5950 | |
| 18 | V | A | 3.0866 | |
| 19 | F | A | 3.7815 | |
| 20 | A | A | 1.5178 | mutated: FA20A |
| 21 | A | A | -0.2202 | |
| 22 | E | A | -2.2079 | |
| 23 | D | A | -1.9202 | |
| 24 | V | A | -0.1003 | |
| 25 | G | A | -0.3905 | |
| 26 | S | A | -1.0979 | |
| 27 | N | A | -1.9872 | |
| 28 | K | A | -1.9822 | |
| 29 | G | A | -0.3205 | |
| 30 | A | A | 0.7022 | |
| 31 | I | A | 3.2549 | |
| 32 | I | A | 4.0616 | |
| 33 | G | A | 2.2687 | |
| 34 | L | A | 3.0773 | |
| 35 | M | A | 3.1988 | |
| 36 | V | A | 2.5194 | |
| 37 | G | A | 0.9708 | |
| 38 | G | A | 0.9736 | |
| 39 | V | A | 2.9950 | |
| 40 | V | A | 3.4564 | |
| 41 | I | A | 2.8702 | |
| 42 | A | A | 1.1978 |