Project name: obj1 [mutate: IC93C, GV113C, LS115C, TR117C, YF59C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	IC93C,TR117C,LS115C,GV113C,YF59C
Energy difference between WT (input) and mutated protein (by FoldX)	7.71739 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:43)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:07)

• Minimal score value: -3.328
• Maximal score value: 1.5458
• Average score: -0.7655
• Total score value: -91.8655

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9175
3	Q	C	-1.2456
4	L	C	0.0000
5	V	C	0.6538
6	E	C	0.1585
7	S	C	-0.5523
8	G	C	-1.0734
9	G	C	-0.8230
10	G	C	-0.1096
11	L	C	0.5380
12	V	C	-0.4840
13	Q	C	-1.5823
14	P	C	-1.6582
15	G	C	-1.4159
16	G	C	-0.9828
17	S	C	-1.2339
18	L	C	-0.9720
19	R	C	-2.1462
20	L	C	0.0000
21	S	C	-0.5418
22	C	C	0.0000
23	A	C	-0.2017
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0330
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.1436
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.7385
40	A	C	-1.5089
41	P	C	-1.3764
42	G	C	-1.4636
43	K	C	-2.1869
44	G	C	-1.1467
45	L	C	0.1873
46	E	C	-0.4679
47	W	C	0.3034
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5509
53	G	C	-1.2475
54	S	C	-1.2308
55	G	C	-1.0849
56	G	C	-0.7391
57	S	C	-0.2549
58	T	C	0.3208
59	F	C	0.8703	mutated: YF59C
60	Y	C	-0.2299
61	A	C	-1.0830
62	D	C	-2.3163
63	S	C	-1.7159
64	V	C	0.0000
65	K	C	-2.3488
66	G	C	-1.6176
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6427
70	I	C	0.0000
71	S	C	-0.5634
72	R	C	-1.3627
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6696
81	L	C	0.0000
82	Q	C	-1.2337
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.6624
88	A	C	-2.1989
89	E	C	-2.5499
90	D	C	0.0000
91	T	C	-1.4927
92	A	C	0.0000
93	C	C	-0.2373	mutated: IC93C
94	Y	C	0.0000
95	Y	C	0.4846
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1872
101	D	C	-3.3280
102	G	C	-2.0746
103	F	C	-1.1755
104	N	C	-2.4172
105	K	C	-3.1784
106	G	C	-1.9029
107	F	C	-0.9845
108	D	C	-1.1011
109	Y	C	-0.2141
110	W	C	0.6252
111	G	C	0.0796
112	Q	C	-0.6938
113	V	C	0.0622	mutated: GV113C
114	T	C	-0.1708
115	S	C	-0.4811	mutated: LS115C
116	V	C	0.0000
117	R	C	-1.8289	mutated: TR117C
118	V	C	0.0000
119	S	C	-1.1432
120	S	C	-1.2241