Project name: 7175720e9b3c5d

Chain sequence(s)	A: MEFGLSWVFLAAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:06)

• Minimal score value: -2.6798
• Maximal score value: 4.4628
• Average score: -0.3356
• Total score value: -39.2615

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.6105
2	E	A	-0.2477
3	F	A	1.6329
4	G	A	1.3280
5	L	A	2.4810
6	S	A	2.4541
7	W	A	3.5982
8	V	A	4.0274
9	F	A	4.4628
10	L	A	4.1021
11	A	A	2.8524
12	A	A	2.5422
13	I	A	3.1272
14	L	A	2.1213
15	K	A	-0.3638
16	G	A	0.0004
17	V	A	0.9862
18	Q	A	-0.7872
19	C	A	-0.2880
20	E	A	-1.4505
21	V	A	-0.5612
22	Q	A	-0.4539
23	L	A	0.3940
24	V	A	1.3759
25	E	A	0.2247
26	S	A	-0.6554
27	G	A	-1.3989
28	G	A	-0.6844
29	G	A	-0.0709
30	L	A	1.1806
31	V	A	0.1526
32	Q	A	-1.1320
33	P	A	-1.2924
34	G	A	-1.3533
35	G	A	-0.7823
36	S	A	-1.0292
37	L	A	-0.7953
38	R	A	-1.9955
39	L	A	0.0000
40	S	A	-0.5183
41	C	A	0.0000
42	A	A	-0.1581
43	A	A	0.0000
44	S	A	-0.4690
45	G	A	-0.5386
46	F	A	-0.1717
47	T	A	-0.3928
48	F	A	0.0000
49	S	A	-1.5753
50	N	A	-1.5969
51	S	A	-1.6169
52	D	A	-2.2373
53	M	A	0.0000
54	N	A	-0.7307
55	W	A	0.0000
56	V	A	0.0000
57	H	A	0.1772
58	Q	A	-0.3336
59	A	A	-1.0258
60	P	A	-0.9524
61	G	A	-1.5758
62	K	A	-2.2690
63	G	A	-1.1996
64	L	A	0.3132
65	E	A	-1.1661
66	W	A	0.1077
67	V	A	0.0000
68	S	A	0.0000
69	G	A	-0.8987
70	V	A	0.0000
71	S	A	0.0000
72	W	A	-1.4227
73	N	A	-1.9199
74	G	A	-1.6557
75	S	A	-1.4413
76	R	A	-2.4821
77	T	A	-1.4966
78	H	A	-1.6651
79	Y	A	-1.1496
80	A	A	-1.6442
81	D	A	-2.6245
82	S	A	-1.8135
83	V	A	0.0000
84	K	A	-2.5828
85	G	A	-1.5030
86	R	A	-1.1443
87	F	A	0.0000
88	I	A	0.2624
89	I	A	0.0000
90	S	A	-0.1681
91	R	A	-1.3715
92	D	A	-2.0832
93	N	A	-2.2438
94	S	A	-1.8380
95	R	A	-2.6798
96	N	A	-1.9139
97	T	A	0.0000
98	L	A	0.0000
99	Y	A	-0.5722
100	L	A	0.0000
101	Q	A	-0.7670
102	T	A	0.0000
103	N	A	-1.0012
104	S	A	-1.1358
105	L	A	0.0000
106	R	A	-2.3550
107	A	A	-1.7156
108	E	A	-2.2858
109	D	A	0.0000
110	T	A	-0.4384
111	A	A	0.1898
112	V	A	1.6236
113	Y	A	0.9886
114	Y	A	1.4378
115	C	A	0.0000
116	V	A	-0.2688
117	R	A	-1.8644