Project name: GP-EX

Chain sequence(s)	A: SLVEEELFREIDRYLEEKAVQLFLEWLKNGGPS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:07)

• Minimal score value: -3.2031
• Maximal score value: 1.9001
• Average score: -0.82
• Total score value: -27.0613

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	0.1457
2	L	A	1.3007
3	V	A	1.1674
4	E	A	-0.7132
5	E	A	-1.2901
6	E	A	-1.7737
7	L	A	-0.3808
8	F	A	-0.1438
9	R	A	-2.6140
10	E	A	-2.6640
11	I	A	-0.7385
12	D	A	-2.7466
13	R	A	-3.2031
14	Y	A	-1.0745
15	L	A	-1.1848
16	E	A	-2.8686
17	E	A	-2.5466
18	K	A	-1.5063
19	A	A	-0.3604
20	V	A	0.2653
21	Q	A	-0.2865
22	L	A	1.1493
23	F	A	1.9001
24	L	A	0.8125
25	E	A	-0.9362
26	W	A	0.3082
27	L	A	-0.1057
28	K	A	-1.9391
29	N	A	-2.0889
30	G	A	-1.5611
31	G	A	-0.5430
32	P	A	-0.3931
33	S	A	-0.4479