| Chain sequence(s) |
A: SPALQALSPLLGSWAGRGAIDEEYLEEVVFAHVGKPFLTYTQQTRFDRVLKTDVNKQFEMGAAPTGDADLTTAPTPASRENPAYGKHMQDAEMLHSETGYLRVSRPGSVELVLAGATSGYLKGNSAAFNLVGLFGRDETAVAADDIPNVSLSQAVVELYTDTAFATEIEVGTYSVTGDVIELELSTRDQSKPKVEELNVLCNAAEFTINKPKGYVGQEFPLNIKAGTVSATDTKDASIDYHEDRSYRIDGDELSYSLQMASFDADTIRIAQPKLETSILKMTTWNPTISGSGIDVDTKITDTLQIVSLQLNKMKSRDLAAVLHRQR
C: SPALQALSPLLGSWAGRGAIDEEYLEEVVFAHVGKPFLTYTQQTRFDRVLKTDVNKQFEMGAAPTGDADLTTAPTPASRENPAYGKHMQDAEMLHSETGYLRVSRPGSVELVLAGATSGYLKGNSAAFNLVGLFGRDETAVAADDIPNVSLSQAVVELYTDTAFATEIEVGTYSVTGDVIELELSTRDQSKPKVEELNVLCNAAEFTINKPKGYVGQEFPLNIKAGTVSATDTKDASIDYHEDRSYRIDGDELSYSLQMASFDADTIRIAQPKLETSILKMTTWNPTISGSGIDVDTKITDTLQIVSLQLNKMKSRDLAAVLHRQR B: SPALQALSPLLGSWAGRGAIDEEYLEEVVFAHVGKPFLTYTQQTRFDRVLKTDVNKQFEMGAAPTGDADLTTAPTPASRENPAYGKHMQDAEMLHSETGYLRVSRPGSVELVLAGATSGYLKGNSAAFNLVGLFGRDETAVAADDIPNVSLSQAVVELYTDTAFATEIEVGTYSVTGDVIELELSTRDQSKPKVEELNVLCNAAEFTINKPKGYVGQEFPLNIKAGTVSATDTKDASIDYHEDRSYRIDGDELSYSLQMASFDADTIRIAQPKLETSILKMTTWNPTISGSGIDVDTKITDTLQIVSLQLNKMKSRDLAAVLHRQR input PDB |
| Selected Chain(s) | A,B,C |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with all chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:01)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:23:27)
[INFO] Auto_mut: Residue number 168 from chain C and a score of 2.058 (isoleucine) selected
for automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 168 from chain B and a score of 1.856 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 170 from chain C and a score of 1.637 (valine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 170 from chain B and a score of 1.630 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 112 from chain C and a score of 1.585 (valine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 170 from chain A and a score of 1.508 (valine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 164 from chain C and a score of 1.439 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 112 from chain B and a score of 1.433 (valine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 168 from chain A and a score of 1.384 (isoleucine) selected
for automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 228 from chain A and a score of 1.339 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 228 from chain B and a score of 1.299 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 321 from chain C and a score of 1.298 (valine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 228 from chain C and a score of 1.290 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 164 from chain B and a score of 1.283 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 112 from chain A and a score of 1.230 (valine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 164 from chain A and a score of 1.191 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 169 from chain C and a score of 1.184 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 169 from chain B and a score of 1.092 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 100 from chain C and a score of 1.082 (tyrosine) selected
for automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 321 from chain B and a score of 1.016 (valine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 321 from chain A and a score of 0.988 (valine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 100 from chain B and a score of 0.953 (tyrosine) selected
for automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 100 from chain A and a score of 0.913 (tyrosine) selected
for automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 169 from chain A and a score of 0.827 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 114 from chain C and a score of 0.825 (alanine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 99 from chain C and a score of 0.708 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 114 from chain B and a score of 0.688 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 114 from chain A and a score of 0.611 (alanine) selected for
automated muatation (00:23:43)
[INFO] Auto_mut: Residue number 99 from chain B and a score of 0.605 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 99 from chain A and a score of 0.554 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 293 from chain C and a score of 0.532 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 229 from chain A and a score of 0.442 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 110 from chain C and a score of 0.411 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 166 from chain C and a score of 0.396 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 229 from chain B and a score of 0.390 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 20 from chain B and a score of 0.383 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 110 from chain B and a score of 0.375 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 98 from chain C and a score of 0.375 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 229 from chain C and a score of 0.372 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 293 from chain B and a score of 0.356 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 165 from chain C and a score of 0.342 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 305 from chain B and a score of 0.336 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 305 from chain A and a score of 0.325 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 227 from chain A and a score of 0.290 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 98 from chain B and a score of 0.290 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 305 from chain C and a score of 0.276 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 98 from chain A and a score of 0.264 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 110 from chain A and a score of 0.263 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 293 from chain A and a score of 0.259 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 227 from chain B and a score of 0.228 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 166 from chain B and a score of 0.214 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 165 from chain B and a score of 0.209 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 165 from chain A and a score of 0.186 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 19 from chain B and a score of 0.148 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 175 from chain A and a score of 0.126 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 96 from chain C and a score of 0.122 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 166 from chain A and a score of 0.115 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 179 from chain C and a score of 0.110 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 18 from chain C and a score of 0.110 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 304 from chain B and a score of 0.083 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 175 from chain B and a score of 0.082 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 16 from chain C and a score of 0.079 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 25 from chain C and a score of 0.077 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 175 from chain C and a score of 0.074 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 295 from chain C and a score of 0.068 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 274 from chain A and a score of 0.067 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 141 from chain A and a score of 0.065 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 141 from chain B and a score of 0.060 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 20 from chain A and a score of 0.056 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 295 from chain A and a score of 0.055 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 17 from chain C and a score of 0.054 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 283 from chain A and a score of 0.051 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 284 from chain A and a score of 0.048 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 18 from chain B and a score of 0.048 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 304 from chain A and a score of 0.046 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 304 from chain C and a score of 0.038 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 19 from chain C and a score of 0.031 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 274 from chain B and a score of 0.030 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 141 from chain C and a score of 0.021 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 15 from chain C and a score of 0.019 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 96 from chain B and a score of 0.015 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 283 from chain B and a score of 0.014 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 284 from chain B and a score of 0.011 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 7 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 10 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 12 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 13 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 14 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 24 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 26 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 27 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 28 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 29 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 30 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 31 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 38 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 39 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 40 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 42 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 44 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 46 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 49 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 50 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 52 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 58 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 60 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 61 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 81 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 83 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 88 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 89 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 91 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 93 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 95 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 96 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 97 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 101 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 109 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 115 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 116 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 117 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 118 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 120 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 121 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 122 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 123 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 125 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 126 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 127 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 128 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 129 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 130 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 131 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 132 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 133 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 134 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 135 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 136 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 145 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 147 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 148 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 151 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 154 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 155 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 156 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 157 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 158 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 159 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 160 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 173 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 180 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 182 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 184 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 186 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 188 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 190 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 192 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 194 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 196 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 197 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 198 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 199 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 200 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 201 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 202 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 203 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 204 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 205 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 206 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 207 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 211 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 213 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 214 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 225 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 236 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 238 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 240 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 242 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 244 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 246 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 248 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 253 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 255 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 257 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 260 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 262 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 264 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 267 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 268 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 269 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 271 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 279 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 281 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 285 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 286 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 287 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 288 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 289 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 294 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 299 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 300 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 302 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 303 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 306 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 307 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 308 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 309 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 310 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 311 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 313 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 315 from chain A and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 7 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 10 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 12 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 13 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 14 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 16 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 24 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 26 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 28 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 30 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 31 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 38 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 39 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 40 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 42 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 43 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 44 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 46 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 49 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 50 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 52 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 58 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 60 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 61 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 81 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 83 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 88 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 89 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 91 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 93 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 95 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 97 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 109 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 113 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 115 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 116 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 117 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 118 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 121 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 122 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 123 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 125 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 126 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 127 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 128 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 129 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 130 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 131 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 132 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 133 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 134 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 135 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 136 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 145 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 147 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 148 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 151 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 154 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 155 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 156 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 157 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 158 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 159 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 160 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 173 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 180 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 182 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 184 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 188 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 190 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 192 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 194 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 196 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 197 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 198 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 199 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 200 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 201 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 202 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 203 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 204 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 205 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 206 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 207 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 211 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 213 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 214 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 225 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 236 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 238 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 240 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 242 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 244 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 246 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 248 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 253 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 255 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 257 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 260 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 262 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 264 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 267 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 268 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 269 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 271 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 279 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 281 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 285 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 286 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 287 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 288 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 289 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 294 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 299 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 300 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 302 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 303 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 307 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 308 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 309 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 310 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 311 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 313 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 315 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 318 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 325 from chain B and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 4 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 7 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 10 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 12 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 13 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 14 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 24 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 26 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 28 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 29 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 30 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 38 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 39 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 40 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 42 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 43 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 44 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 46 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 49 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 50 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 52 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 58 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 60 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 61 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 81 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 83 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 88 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 89 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 91 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 93 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 95 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 97 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:43)
[INFO] Auto_mut: Residue number 109 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 115 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 116 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 117 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 118 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 119 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 121 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 122 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 123 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 125 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 126 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 127 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 128 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 129 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 130 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 131 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 132 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 133 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 134 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 135 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 136 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 145 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 147 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 148 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 151 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 154 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 155 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 156 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 157 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 158 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 159 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 160 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 173 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 180 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 182 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 184 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 186 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 188 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 190 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 192 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 194 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 196 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 197 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 198 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 199 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 200 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 201 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 202 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 203 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 204 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 205 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 206 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 207 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 211 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 213 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 214 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 225 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 227 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 236 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 238 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 240 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 242 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 244 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 246 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 248 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 253 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 255 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 257 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 260 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 262 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 264 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 267 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 268 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 269 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 271 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 279 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 281 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 284 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 285 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 286 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 287 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 288 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 289 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 294 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 299 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 300 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 302 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 303 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 306 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 307 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 308 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 309 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 310 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 311 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 313 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 315 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 325 from chain C and a score of 0.000 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 15 from chain A and a score of -0.005 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 41 from chain A and a score of -0.008 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 41 from chain B and a score of -0.011 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 41 from chain C and a score of -0.011 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 272 from chain A and a score of -0.013 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 179 from chain A and a score of -0.014 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 171 from chain B and a score of -0.017 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 16 from chain A and a score of -0.019 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 25 from chain A and a score of -0.021 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 20 from chain C and a score of -0.021 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 63 from chain B and a score of -0.022 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 63 from chain A and a score of -0.024 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 63 from chain C and a score of -0.025 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 171 from chain A and a score of -0.026 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 272 from chain B and a score of -0.027 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 19 from chain A and a score of -0.032 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 163 from chain C and a score of -0.040 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 94 from chain C and a score of -0.048 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 274 from chain C and a score of -0.051 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 167 from chain C and a score of -0.052 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 18 from chain A and a score of -0.057 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 223 from chain A and a score of -0.077 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 94 from chain B and a score of -0.089 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 94 from chain A and a score of -0.091 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 15 from chain B and a score of -0.104 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 25 from chain B and a score of -0.105 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 272 from chain C and a score of -0.107 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 179 from chain B and a score of -0.113 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 17 from chain A and a score of -0.116 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 163 from chain B and a score of -0.116 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 171 from chain C and a score of -0.119 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 150 from chain C and a score of -0.120 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 17 from chain B and a score of -0.121 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 150 from chain B and a score of -0.121 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 223 from chain B and a score of -0.121 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 150 from chain A and a score of -0.121 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 283 from chain C and a score of -0.128 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 176 from chain A and a score of -0.134 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 11 from chain C and a score of -0.154 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 176 from chain C and a score of -0.154 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 43 from chain A and a score of -0.163 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 163 from chain A and a score of -0.166 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 273 from chain A and a score of -0.168 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 273 from chain B and a score of -0.172 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 282 from chain A and a score of -0.180 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 64 from chain B and a score of -0.184 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 120 from chain B and a score of -0.186 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 176 from chain B and a score of -0.187 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 120 from chain C and a score of -0.194 omitted from
automated muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 75 from chain B and a score of -0.196 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 75 from chain A and a score of -0.196 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 75 from chain C and a score of -0.196 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Residue number 29 from chain B and a score of -0.200 omitted from automated
muatation (excluded by the user). (00:23:44)
[INFO] Auto_mut: Mutating residue number 168 from chain C (isoleucine) into glutamic acid (00:23:44)
[INFO] Auto_mut: Mutating residue number 170 from chain C (valine) into lysine (00:23:44)
[INFO] Auto_mut: Mutating residue number 112 from chain C (valine) into aspartic acid (00:23:44)
[INFO] Auto_mut: Mutating residue number 112 from chain C (valine) into arginine (00:34:22)
[INFO] Auto_mut: Mutating residue number 168 from chain C (isoleucine) into lysine (00:34:26)
[INFO] Auto_mut: Mutating residue number 170 from chain C (valine) into aspartic acid (00:34:39)
[INFO] Auto_mut: Mutating residue number 170 from chain A (valine) into glutamic acid (00:45:22)
[INFO] Auto_mut: Mutating residue number 168 from chain C (isoleucine) into aspartic acid (00:45:27)
[INFO] Auto_mut: Mutating residue number 170 from chain C (valine) into arginine (00:45:27)
[INFO] Auto_mut: Mutating residue number 170 from chain A (valine) into lysine (00:56:16)
[INFO] Auto_mut: Mutating residue number 112 from chain C (valine) into glutamic acid (00:56:21)
[INFO] Auto_mut: Mutating residue number 168 from chain C (isoleucine) into arginine (00:56:22)
[INFO] Auto_mut: Mutating residue number 170 from chain A (valine) into aspartic acid (01:06:57)
[INFO] Auto_mut: Mutating residue number 112 from chain C (valine) into lysine (01:06:58)
[INFO] Auto_mut: Mutating residue number 170 from chain C (valine) into glutamic acid (01:07:11)
[INFO] Auto_mut: Mutating residue number 170 from chain A (valine) into arginine (01:17:39)
[INFO] Auto_mut: Mutating residue number 168 from chain A (isoleucine) into glutamic acid (01:17:52)
[INFO] Auto_mut: Mutating residue number 321 from chain C (valine) into lysine (01:17:58)
[INFO] Auto_mut: Mutating residue number 168 from chain A (isoleucine) into lysine (01:28:47)
[INFO] Auto_mut: Mutating residue number 112 from chain B (valine) into glutamic acid (01:28:47)
[INFO] Auto_mut: Mutating residue number 321 from chain C (valine) into aspartic acid (01:29:04)
[INFO] Auto_mut: Mutating residue number 168 from chain A (isoleucine) into aspartic acid (01:38:49)
[INFO] Auto_mut: Mutating residue number 112 from chain B (valine) into lysine (01:39:24)
[INFO] Auto_mut: Mutating residue number 321 from chain C (valine) into arginine (01:40:01)
[INFO] Auto_mut: Mutating residue number 168 from chain A (isoleucine) into arginine (01:49:59)
[INFO] Auto_mut: Mutating residue number 112 from chain B (valine) into aspartic acid (01:50:22)
[INFO] Auto_mut: Mutating residue number 112 from chain A (valine) into glutamic acid (01:51:10)
[INFO] Auto_mut: Mutating residue number 321 from chain C (valine) into glutamic acid (02:00:48)
[INFO] Auto_mut: Mutating residue number 112 from chain B (valine) into arginine (02:00:54)
[INFO] Auto_mut: Mutating residue number 112 from chain A (valine) into lysine (02:02:09)
[INFO] Auto_mut: Mutating residue number 112 from chain A (valine) into aspartic acid (02:11:36)
[INFO] Auto_mut: Mutating residue number 100 from chain C (tyrosine) into arginine (02:11:49)
[INFO] Auto_mut: Mutating residue number 321 from chain A (valine) into glutamic acid (02:13:13)
[INFO] Auto_mut: Mutating residue number 321 from chain B (valine) into glutamic acid (02:21:52)
[INFO] Auto_mut: Mutating residue number 112 from chain A (valine) into arginine (02:22:20)
[INFO] Auto_mut: Mutating residue number 321 from chain A (valine) into lysine (02:23:58)
[INFO] Auto_mut: Mutating residue number 321 from chain B (valine) into lysine (02:32:53)
[INFO] Auto_mut: Mutating residue number 100 from chain C (tyrosine) into glutamic acid (02:33:47)
[INFO] Auto_mut: Mutating residue number 321 from chain A (valine) into aspartic acid (02:35:14)
[INFO] Auto_mut: Mutating residue number 321 from chain B (valine) into aspartic acid (02:43:25)
[INFO] Auto_mut: Mutating residue number 100 from chain C (tyrosine) into lysine (02:44:00)
[INFO] Auto_mut: Mutating residue number 321 from chain A (valine) into arginine (02:46:02)
[INFO] Auto_mut: Mutating residue number 321 from chain B (valine) into arginine (02:54:06)
[INFO] Auto_mut: Mutating residue number 100 from chain C (tyrosine) into aspartic acid (02:54:33)
[INFO] Auto_mut: Mutating residue number 100 from chain B (tyrosine) into glutamic acid (02:56:46)
[INFO] Auto_mut: Mutating residue number 100 from chain B (tyrosine) into lysine (03:04:53)
[INFO] Auto_mut: Mutating residue number 100 from chain A (tyrosine) into aspartic acid (03:04:53)
[INFO] Auto_mut: Mutating residue number 114 from chain C (alanine) into arginine (03:07:41)
[INFO] Auto_mut: Mutating residue number 100 from chain B (tyrosine) into aspartic acid (03:15:03)
[INFO] Auto_mut: Mutating residue number 100 from chain A (tyrosine) into arginine (03:15:49)
[INFO] Auto_mut: Mutating residue number 114 from chain A (alanine) into glutamic acid (03:18:46)
[INFO] Auto_mut: Mutating residue number 100 from chain B (tyrosine) into arginine (03:25:44)
[INFO] Auto_mut: Mutating residue number 114 from chain C (alanine) into glutamic acid (03:26:54)
[INFO] Auto_mut: Mutating residue number 114 from chain A (alanine) into lysine (03:29:42)
[INFO] Auto_mut: Mutating residue number 100 from chain A (tyrosine) into glutamic acid (03:36:18)
[INFO] Auto_mut: Mutating residue number 114 from chain C (alanine) into lysine (03:37:26)
[INFO] Auto_mut: Mutating residue number 114 from chain A (alanine) into aspartic acid (03:40:44)
[INFO] Auto_mut: Mutating residue number 100 from chain A (tyrosine) into lysine (03:46:12)
[INFO] Auto_mut: Mutating residue number 114 from chain C (alanine) into aspartic acid (03:48:17)
[INFO] Auto_mut: Mutating residue number 114 from chain A (alanine) into arginine (03:50:54)
[INFO] Auto_mut: Effect of mutation residue number 168 from chain C (isoleucine) into
glutamic acid: Energy difference: 1.1721 kcal/mol, Difference in average
score from the base case: -0.0103 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 168 from chain C (isoleucine) into
lysine: Energy difference: 0.2716 kcal/mol, Difference in average score
from the base case: -0.0087 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 168 from chain C (isoleucine) into
aspartic acid: Energy difference: 1.6609 kcal/mol, Difference in average
score from the base case: -0.0089 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 168 from chain C (isoleucine) into
arginine: Energy difference: -0.5953 kcal/mol, Difference in average score
from the base case: -0.0098 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 170 from chain C (valine) into glutamic
acid: Energy difference: 0.2774 kcal/mol, Difference in average score from
the base case: -0.0064 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 170 from chain C (valine) into lysine:
Energy difference: -0.2906 kcal/mol, Difference in average score from the
base case: -0.0080 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 170 from chain C (valine) into aspartic
acid: Energy difference: 0.8163 kcal/mol, Difference in average score from
the base case: -0.0094 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 170 from chain C (valine) into arginine:
Energy difference: -0.5518 kcal/mol, Difference in average score from the
base case: -0.0128 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain C (valine) into glutamic
acid: Energy difference: 0.4475 kcal/mol, Difference in average score from
the base case: -0.0073 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain C (valine) into lysine:
Energy difference: -0.0619 kcal/mol, Difference in average score from the
base case: -0.0034 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain C (valine) into aspartic
acid: Energy difference: 1.1527 kcal/mol, Difference in average score from
the base case: -0.0039 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain C (valine) into arginine:
Energy difference: 0.4002 kcal/mol, Difference in average score from the
base case: -0.0105 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 170 from chain A (valine) into glutamic
acid: Energy difference: 0.2736 kcal/mol, Difference in average score from
the base case: -0.0077 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 170 from chain A (valine) into lysine:
Energy difference: -0.2698 kcal/mol, Difference in average score from the
base case: -0.0080 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 170 from chain A (valine) into aspartic
acid: Energy difference: 0.9319 kcal/mol, Difference in average score from
the base case: -0.0112 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 170 from chain A (valine) into arginine:
Energy difference: -0.4837 kcal/mol, Difference in average score from the
base case: -0.0158 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain B (valine) into glutamic
acid: Energy difference: 0.3740 kcal/mol, Difference in average score from
the base case: -0.0023 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain B (valine) into lysine:
Energy difference: 0.0236 kcal/mol, Difference in average score from the
base case: -0.0001 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain B (valine) into aspartic
acid: Energy difference: 1.2512 kcal/mol, Difference in average score from
the base case: -0.0010 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain B (valine) into arginine:
Energy difference: -0.0117 kcal/mol, Difference in average score from the
base case: -0.0068 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 168 from chain A (isoleucine) into
glutamic acid: Energy difference: 1.4081 kcal/mol, Difference in average
score from the base case: -0.0071 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 168 from chain A (isoleucine) into
lysine: Energy difference: 0.6045 kcal/mol, Difference in average score
from the base case: -0.0070 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 168 from chain A (isoleucine) into
aspartic acid: Energy difference: 2.1798 kcal/mol, Difference in average
score from the base case: -0.0085 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 168 from chain A (isoleucine) into
arginine: Energy difference: -0.3853 kcal/mol, Difference in average score
from the base case: -0.0054 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain C (valine) into glutamic
acid: Energy difference: 0.3447 kcal/mol, Difference in average score from
the base case: -0.0079 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain C (valine) into lysine:
Energy difference: -0.0073 kcal/mol, Difference in average score from the
base case: -0.0045 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain C (valine) into aspartic
acid: Energy difference: -0.1578 kcal/mol, Difference in average score from
the base case: -0.0077 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain C (valine) into arginine:
Energy difference: -0.2488 kcal/mol, Difference in average score from the
base case: -0.0063 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain A (valine) into glutamic
acid: Energy difference: 0.4596 kcal/mol, Difference in average score from
the base case: -0.0130 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain A (valine) into lysine:
Energy difference: 0.3566 kcal/mol, Difference in average score from the
base case: 0.0001 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain A (valine) into aspartic
acid: Energy difference: 1.3525 kcal/mol, Difference in average score from
the base case: -0.0082 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 112 from chain A (valine) into arginine:
Energy difference: 0.3135 kcal/mol, Difference in average score from the
base case: -0.0097 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain C (tyrosine) into glutamic
acid: Energy difference: 1.6476 kcal/mol, Difference in average score from
the base case: -0.0002 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain C (tyrosine) into lysine:
Energy difference: 1.8218 kcal/mol, Difference in average score from the
base case: 0.0026 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain C (tyrosine) into aspartic
acid: Energy difference: 2.2969 kcal/mol, Difference in average score from
the base case: -0.0003 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain C (tyrosine) into
arginine: Energy difference: -0.8130 kcal/mol, Difference in average score
from the base case: -0.0034 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain B (valine) into glutamic
acid: Energy difference: 0.5789 kcal/mol, Difference in average score from
the base case: -0.0035 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain B (valine) into lysine:
Energy difference: -0.3514 kcal/mol, Difference in average score from the
base case: -0.0011 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain B (valine) into aspartic
acid: Energy difference: 0.1662 kcal/mol, Difference in average score from
the base case: -0.0036 (04:02:07)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain B (valine) into arginine:
Energy difference: -0.3592 kcal/mol, Difference in average score from the
base case: -0.0032 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain A (valine) into glutamic
acid: Energy difference: 1.1377 kcal/mol, Difference in average score from
the base case: -0.0046 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain A (valine) into lysine:
Energy difference: -0.0306 kcal/mol, Difference in average score from the
base case: -0.0058 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain A (valine) into aspartic
acid: Energy difference: 0.8744 kcal/mol, Difference in average score from
the base case: -0.0066 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 321 from chain A (valine) into arginine:
Energy difference: -1.6155 kcal/mol, Difference in average score from the
base case: -0.0040 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain B (tyrosine) into glutamic
acid: Energy difference: 1.5787 kcal/mol, Difference in average score from
the base case: -0.0015 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain B (tyrosine) into lysine:
Energy difference: 1.1113 kcal/mol, Difference in average score from the
base case: -0.0000 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain B (tyrosine) into aspartic
acid: Energy difference: 2.3569 kcal/mol, Difference in average score from
the base case: 0.0013 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain B (tyrosine) into
arginine: Energy difference: -1.1302 kcal/mol, Difference in average score
from the base case: -0.0025 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain A (tyrosine) into glutamic
acid: Energy difference: 1.9866 kcal/mol, Difference in average score from
the base case: 0.0005 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain A (tyrosine) into lysine:
Energy difference: 1.8553 kcal/mol, Difference in average score from the
base case: -0.0007 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain A (tyrosine) into aspartic
acid: Energy difference: 2.5989 kcal/mol, Difference in average score from
the base case: -0.0040 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 100 from chain A (tyrosine) into
arginine: Energy difference: -0.4538 kcal/mol, Difference in average score
from the base case: -0.0065 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain C (alanine) into glutamic
acid: Energy difference: -0.5564 kcal/mol, Difference in average score from
the base case: 0.0021 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain C (alanine) into lysine:
Energy difference: -1.1658 kcal/mol, Difference in average score from the
base case: 0.0013 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain C (alanine) into aspartic
acid: Energy difference: -0.7591 kcal/mol, Difference in average score from
the base case: 0.0034 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain C (alanine) into arginine:
Energy difference: -1.3307 kcal/mol, Difference in average score from the
base case: -0.0021 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain A (alanine) into glutamic
acid: Energy difference: -0.5804 kcal/mol, Difference in average score from
the base case: -0.0024 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain A (alanine) into lysine:
Energy difference: -1.7073 kcal/mol, Difference in average score from the
base case: -0.0003 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain A (alanine) into aspartic
acid: Energy difference: -0.8819 kcal/mol, Difference in average score from
the base case: 0.0025 (04:02:08)
[INFO] Auto_mut: Effect of mutation residue number 114 from chain A (alanine) into arginine:
Energy difference: -1.4369 kcal/mol, Difference in average score from the
base case: -0.0092 (04:02:08)
[INFO] Main: Simulation completed successfully. (04:02:45)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | S | A | -0.7682 | |
| 2 | P | A | -0.7018 | |
| 3 | A | A | -0.9695 | |
| 4 | L | A | -1.0646 | |
| 5 | Q | A | -1.3102 | |
| 6 | A | A | -0.6997 | |
| 7 | L | A | 0.0000 | |
| 8 | S | A | -0.4910 | |
| 9 | P | A | -0.4012 | |
| 10 | L | A | 0.0000 | |
| 11 | L | A | -0.2728 | |
| 12 | G | A | 0.0000 | |
| 13 | S | A | 0.0000 | |
| 14 | W | A | 0.0000 | |
| 15 | A | A | -0.0054 | |
| 16 | G | A | -0.0189 | |
| 17 | R | A | -0.1157 | |
| 18 | G | A | -0.0566 | |
| 19 | A | A | -0.0318 | |
| 20 | I | A | 0.0555 | |
| 21 | D | A | -0.8676 | |
| 22 | E | A | -1.0717 | |
| 23 | E | A | -0.7444 | |
| 24 | Y | A | 0.0000 | |
| 25 | L | A | -0.0209 | |
| 26 | E | A | 0.0000 | |
| 27 | E | A | 0.0000 | |
| 28 | V | A | 0.0000 | |
| 29 | V | A | 0.0000 | |
| 30 | F | A | 0.0000 | |
| 31 | A | A | 0.0000 | |
| 32 | H | A | -0.9722 | |
| 33 | V | A | -0.8526 | |
| 34 | G | A | -1.1923 | |
| 35 | K | A | -1.7341 | |
| 36 | P | A | -1.2594 | |
| 37 | F | A | -0.6743 | |
| 38 | L | A | 0.0000 | |
| 39 | T | A | 0.0000 | |
| 40 | Y | A | 0.0000 | |
| 41 | T | A | -0.0083 | |
| 42 | Q | A | 0.0000 | |
| 43 | Q | A | -0.1625 | |
| 44 | T | A | 0.0000 | |
| 45 | R | A | -0.4237 | |
| 46 | F | A | 0.0000 | |
| 47 | D | A | -0.6651 | |
| 48 | R | A | -1.0032 | |
| 49 | V | A | 0.0000 | |
| 50 | L | A | 0.0000 | |
| 51 | K | A | -2.2032 | |
| 52 | T | A | 0.0000 | |
| 53 | D | A | -2.1940 | |
| 54 | V | A | -1.4530 | |
| 55 | N | A | -2.2870 | |
| 56 | K | A | -2.5636 | |
| 57 | Q | A | -3.0306 | |
| 58 | F | A | 0.0000 | |
| 59 | E | A | -2.2085 | |
| 60 | M | A | 0.0000 | |
| 61 | G | A | 0.0000 | |
| 62 | A | A | -0.3208 | |
| 63 | A | A | -0.0235 | |
| 64 | P | A | -0.2632 | |
| 65 | T | A | -0.3532 | |
| 66 | G | A | -0.7555 | |
| 67 | D | A | -1.2424 | |
| 68 | A | A | -1.2685 | |
| 69 | D | A | -2.2418 | |
| 70 | L | A | -1.1014 | |
| 71 | T | A | -0.8173 | |
| 72 | T | A | -0.4783 | |
| 73 | A | A | -0.4766 | |
| 74 | P | A | -0.2953 | |
| 75 | T | A | -0.1963 | |
| 76 | P | A | -0.5882 | |
| 77 | A | A | -0.9704 | |
| 78 | S | A | -1.6712 | |
| 79 | R | A | -2.1770 | |
| 80 | E | A | -2.9321 | |
| 81 | N | A | 0.0000 | |
| 82 | P | A | -0.8379 | |
| 83 | A | A | 0.0000 | |
| 84 | Y | A | -0.8055 | |
| 85 | G | A | -1.0335 | |
| 86 | K | A | -1.5195 | |
| 87 | H | A | -2.0775 | |
| 88 | M | A | 0.0000 | |
| 89 | Q | A | 0.0000 | |
| 90 | D | A | -0.6179 | |
| 91 | A | A | 0.0000 | |
| 92 | E | A | -0.6852 | |
| 93 | M | A | 0.0000 | |
| 94 | L | A | -0.0909 | |
| 95 | H | A | 0.0000 | |
| 96 | S | A | 0.0000 | |
| 97 | E | A | 0.0000 | |
| 98 | T | A | 0.2636 | |
| 99 | G | A | 0.5544 | |
| 100 | Y | A | 0.9135 | |
| 101 | L | A | 0.0000 | |
| 102 | R | A | -1.1385 | |
| 103 | V | A | -1.0221 | |
| 104 | S | A | -1.2318 | |
| 105 | R | A | -2.2189 | |
| 106 | P | A | -1.2105 | |
| 107 | G | A | -0.7179 | |
| 108 | S | A | -0.9453 | |
| 109 | V | A | 0.0000 | |
| 110 | E | A | 0.2626 | |
| 111 | L | A | 0.0000 | |
| 112 | V | A | 1.2305 | |
| 113 | L | A | 0.0000 | |
| 114 | A | A | 0.6109 | |
| 115 | G | A | 0.0000 | |
| 116 | A | A | 0.0000 | |
| 117 | T | A | 0.0000 | |
| 118 | S | A | 0.0000 | |
| 119 | G | A | -0.2636 | |
| 120 | Y | A | 0.0000 | |
| 121 | L | A | 0.0000 | |
| 122 | K | A | 0.0000 | |
| 123 | G | A | 0.0000 | |
| 124 | N | A | -0.6383 | |
| 125 | S | A | 0.0000 | |
| 126 | A | A | 0.0000 | |
| 127 | A | A | 0.0000 | |
| 128 | F | A | 0.0000 | |
| 129 | N | A | 0.0000 | |
| 130 | L | A | 0.0000 | |
| 131 | V | A | 0.0000 | |
| 132 | G | A | 0.0000 | |
| 133 | L | A | 0.0000 | |
| 134 | F | A | 0.0000 | |
| 135 | G | A | 0.0000 | |
| 136 | R | A | 0.0000 | |
| 137 | D | A | -1.6999 | |
| 138 | E | A | -1.4273 | |
| 139 | T | A | -0.8893 | |
| 140 | A | A | -0.2863 | |
| 141 | V | A | 0.0648 | |
| 142 | A | A | -0.2302 | |
| 143 | A | A | -0.6629 | |
| 144 | D | A | -1.6481 | |
| 145 | D | A | 0.0000 | |
| 146 | I | A | 0.0000 | |
| 147 | P | A | 0.0000 | |
| 148 | N | A | 0.0000 | |
| 149 | V | A | 0.0000 | |
| 150 | S | A | -0.1207 | |
| 151 | L | A | 0.0000 | |
| 152 | S | A | -0.2604 | |
| 153 | Q | A | -0.3403 | |
| 154 | A | A | 0.0000 | |
| 155 | V | A | 0.0000 | |
| 156 | V | A | 0.0000 | |
| 157 | E | A | 0.0000 | |
| 158 | L | A | 0.0000 | |
| 159 | Y | A | 0.0000 | |
| 160 | T | A | 0.0000 | |
| 161 | D | A | -1.4778 | |
| 162 | T | A | -0.5846 | |
| 163 | A | A | -0.1661 | |
| 164 | F | A | 1.1907 | |
| 165 | A | A | 0.1863 | |
| 166 | T | A | 0.1149 | |
| 167 | E | A | -0.5814 | |
| 168 | I | A | 1.3838 | |
| 169 | E | A | 0.8265 | |
| 170 | V | A | 1.5077 | |
| 171 | G | A | -0.0257 | |
| 172 | T | A | -0.8501 | |
| 173 | Y | A | 0.0000 | |
| 174 | S | A | -0.4236 | |
| 175 | V | A | 0.1264 | |
| 176 | T | A | -0.1342 | |
| 177 | G | A | -0.7744 | |
| 178 | D | A | -1.2359 | |
| 179 | V | A | -0.0139 | |
| 180 | I | A | 0.0000 | |
| 181 | E | A | -1.5595 | |
| 182 | L | A | 0.0000 | |
| 183 | E | A | -2.2590 | |
| 184 | L | A | 0.0000 | |
| 185 | S | A | -0.9695 | |
| 186 | T | A | 0.0000 | |
| 187 | R | A | -2.7237 | |
| 188 | D | A | 0.0000 | |
| 189 | Q | A | -2.0908 | |
| 190 | S | A | 0.0000 | |
| 191 | K | A | -2.2923 | |
| 192 | P | A | 0.0000 | |
| 193 | K | A | -2.2530 | |
| 194 | V | A | 0.0000 | |
| 195 | E | A | -2.2546 | |
| 196 | E | A | 0.0000 | |
| 197 | L | A | 0.0000 | |
| 198 | N | A | 0.0000 | |
| 199 | V | A | 0.0000 | |
| 200 | L | A | 0.0000 | |
| 201 | C | A | 0.0000 | |
| 202 | N | A | 0.0000 | |
| 203 | A | A | 0.0000 | |
| 204 | A | A | 0.0000 | |
| 205 | E | A | 0.0000 | |
| 206 | F | A | 0.0000 | |
| 207 | T | A | 0.0000 | |
| 208 | I | A | -1.2140 | |
| 209 | N | A | -2.5724 | |
| 210 | K | A | -3.3358 | |
| 211 | P | A | 0.0000 | |
| 212 | K | A | -3.3106 | |
| 213 | G | A | 0.0000 | |
| 214 | Y | A | 0.0000 | |
| 215 | V | A | -1.3462 | |
| 216 | G | A | -1.1390 | |
| 217 | Q | A | -1.3741 | |
| 218 | E | A | -2.0965 | |
| 219 | F | A | -1.4107 | |
| 220 | P | A | -0.9655 | |
| 221 | L | A | -0.8747 | |
| 222 | N | A | -1.2421 | |
| 223 | I | A | -0.0766 | |
| 224 | K | A | -0.5288 | |
| 225 | A | A | 0.0000 | |
| 226 | G | A | -0.2790 | |
| 227 | T | A | 0.2900 | |
| 228 | V | A | 1.3387 | |
| 229 | S | A | 0.4420 | |
| 230 | A | A | -0.5824 | |
| 231 | T | A | -1.4120 | |
| 232 | D | A | -2.4771 | |
| 233 | T | A | -2.3137 | |
| 234 | K | A | -2.9913 | |
| 235 | D | A | -2.9272 | |
| 236 | A | A | 0.0000 | |
| 237 | S | A | -2.3943 | |
| 238 | I | A | 0.0000 | |
| 239 | D | A | -2.2195 | |
| 240 | Y | A | 0.0000 | |
| 241 | H | A | -1.8077 | |
| 242 | E | A | 0.0000 | |
| 243 | D | A | -2.3002 | |
| 244 | R | A | 0.0000 | |
| 245 | S | A | -1.3113 | |
| 246 | Y | A | 0.0000 | |
| 247 | R | A | -1.8567 | |
| 248 | I | A | 0.0000 | |
| 249 | D | A | -2.1388 | |
| 250 | G | A | -1.1419 | |
| 251 | D | A | -1.3238 | |
| 252 | E | A | -1.3199 | |
| 253 | L | A | 0.0000 | |
| 254 | S | A | -0.4101 | |
| 255 | Y | A | 0.0000 | |
| 256 | S | A | -0.7431 | |
| 257 | L | A | 0.0000 | |
| 258 | Q | A | -2.2611 | |
| 259 | M | A | -1.3539 | |
| 260 | A | A | 0.0000 | |
| 261 | S | A | -1.2805 | |
| 262 | F | A | 0.0000 | |
| 263 | D | A | -2.0133 | |
| 264 | A | A | 0.0000 | |
| 265 | D | A | -2.1259 | |
| 266 | T | A | -1.1129 | |
| 267 | I | A | 0.0000 | |
| 268 | R | A | 0.0000 | |
| 269 | I | A | 0.0000 | |
| 270 | A | A | -0.4139 | |
| 271 | Q | A | 0.0000 | |
| 272 | P | A | -0.0127 | |
| 273 | K | A | -0.1677 | |
| 274 | L | A | 0.0665 | |
| 275 | E | A | -0.9725 | |
| 276 | T | A | -0.7244 | |
| 277 | S | A | -0.4783 | |
| 278 | I | A | -0.3543 | |
| 279 | L | A | 0.0000 | |
| 280 | K | A | -0.8353 | |
| 281 | M | A | 0.0000 | |
| 282 | T | A | -0.1802 | |
| 283 | T | A | 0.0515 | |
| 284 | W | A | 0.0483 | |
| 285 | N | A | 0.0000 | |
| 286 | P | A | 0.0000 | |
| 287 | T | A | 0.0000 | |
| 288 | I | A | 0.0000 | |
| 289 | S | A | 0.0000 | |
| 290 | G | A | -0.4687 | |
| 291 | S | A | -0.9515 | |
| 292 | G | A | -0.6398 | |
| 293 | I | A | 0.2593 | |
| 294 | D | A | 0.0000 | |
| 295 | V | A | 0.0550 | |
| 296 | D | A | -0.5823 | |
| 297 | T | A | -0.8588 | |
| 298 | K | A | -1.1522 | |
| 299 | I | A | 0.0000 | |
| 300 | T | A | 0.0000 | |
| 301 | D | A | -0.5690 | |
| 302 | T | A | 0.0000 | |
| 303 | L | A | 0.0000 | |
| 304 | Q | A | 0.0465 | |
| 305 | I | A | 0.3247 | |
| 306 | V | A | 0.0000 | |
| 307 | S | A | 0.0000 | |
| 308 | L | A | 0.0000 | |
| 309 | Q | A | 0.0000 | |
| 310 | L | A | 0.0000 | |
| 311 | N | A | 0.0000 | |
| 312 | K | A | -1.8496 | |
| 313 | M | A | 0.0000 | |
| 314 | K | A | -1.7687 | |
| 315 | S | A | 0.0000 | |
| 316 | R | A | -1.9173 | |
| 317 | D | A | -2.2627 | |
| 318 | L | A | 0.0000 | |
| 319 | A | A | -0.3804 | |
| 320 | A | A | 0.0000 | |
| 321 | V | A | 0.9879 | |
| 322 | L | A | 0.0000 | |
| 323 | H | A | -0.5059 | |
| 324 | R | A | -1.2334 | |
| 325 | Q | A | -1.6376 | |
| 326 | R | A | -2.5670 | |
| 1 | S | B | -0.7497 | |
| 2 | P | B | -0.6988 | |
| 3 | A | B | -0.9524 | |
| 4 | L | B | -1.0176 | |
| 5 | Q | B | -1.2995 | |
| 6 | A | B | -0.6965 | |
| 7 | L | B | 0.0000 | |
| 8 | S | B | -0.4783 | |
| 9 | P | B | -0.4264 | |
| 10 | L | B | 0.0000 | |
| 11 | L | B | -0.2285 | |
| 12 | G | B | 0.0000 | |
| 13 | S | B | 0.0000 | |
| 14 | W | B | 0.0000 | |
| 15 | A | B | -0.1045 | |
| 16 | G | B | 0.0000 | |
| 17 | R | B | -0.1206 | |
| 18 | G | B | 0.0477 | |
| 19 | A | B | 0.1476 | |
| 20 | I | B | 0.3826 | |
| 21 | D | B | -0.5071 | |
| 22 | E | B | -0.9058 | |
| 23 | E | B | -0.6733 | |
| 24 | Y | B | 0.0000 | |
| 25 | L | B | -0.1051 | |
| 26 | E | B | 0.0000 | |
| 27 | E | B | -0.4019 | |
| 28 | V | B | 0.0000 | |
| 29 | V | B | -0.1995 | |
| 30 | F | B | 0.0000 | |
| 31 | A | B | 0.0000 | |
| 32 | H | B | -0.8756 | |
| 33 | V | B | -0.9501 | |
| 34 | G | B | -1.1952 | |
| 35 | K | B | -1.6138 | |
| 36 | P | B | -1.1823 | |
| 37 | F | B | -0.5872 | |
| 38 | L | B | 0.0000 | |
| 39 | T | B | 0.0000 | |
| 40 | Y | B | 0.0000 | |
| 41 | T | B | -0.0111 | |
| 42 | Q | B | 0.0000 | |
| 43 | Q | B | 0.0000 | |
| 44 | T | B | 0.0000 | |
| 45 | R | B | -0.4166 | |
| 46 | F | B | 0.0000 | |
| 47 | D | B | -0.7032 | |
| 48 | R | B | -0.9456 | |
| 49 | V | B | 0.0000 | |
| 50 | L | B | 0.0000 | |
| 51 | K | B | -2.1225 | |
| 52 | T | B | 0.0000 | |
| 53 | D | B | -1.9736 | |
| 54 | V | B | -1.4680 | |
| 55 | N | B | -2.4017 | |
| 56 | K | B | -2.8596 | |
| 57 | Q | B | -3.2668 | |
| 58 | F | B | 0.0000 | |
| 59 | E | B | -2.5345 | |
| 60 | M | B | 0.0000 | |
| 61 | G | B | 0.0000 | |
| 62 | A | B | -0.3671 | |
| 63 | A | B | -0.0224 | |
| 64 | P | B | -0.1845 | |
| 65 | T | B | -0.2842 | |
| 66 | G | B | -0.7271 | |
| 67 | D | B | -1.2206 | |
| 68 | A | B | -1.0218 | |
| 69 | D | B | -1.6502 | |
| 70 | L | B | -0.8175 | |
| 71 | T | B | -0.6748 | |
| 72 | T | B | -0.4148 | |
| 73 | A | B | -0.4890 | |
| 74 | P | B | -0.2958 | |
| 75 | T | B | -0.1961 | |
| 76 | P | B | -0.6630 | |
| 77 | A | B | -1.0767 | |
| 78 | S | B | -1.8564 | |
| 79 | R | B | -2.3197 | |
| 80 | E | B | -3.0688 | |
| 81 | N | B | 0.0000 | |
| 82 | P | B | -0.8959 | |
| 83 | A | B | 0.0000 | |
| 84 | Y | B | -0.8242 | |
| 85 | G | B | -0.9376 | |
| 86 | K | B | -1.1741 | |
| 87 | H | B | -1.3676 | |
| 88 | M | B | 0.0000 | |
| 89 | Q | B | 0.0000 | |
| 90 | D | B | -0.5547 | |
| 91 | A | B | 0.0000 | |
| 92 | E | B | -0.6918 | |
| 93 | M | B | 0.0000 | |
| 94 | L | B | -0.0888 | |
| 95 | H | B | 0.0000 | |
| 96 | S | B | 0.0148 | |
| 97 | E | B | 0.0000 | |
| 98 | T | B | 0.2900 | |
| 99 | G | B | 0.6047 | |
| 100 | Y | B | 0.9533 | |
| 101 | L | B | 0.0000 | |
| 102 | R | B | -1.1198 | |
| 103 | V | B | -1.0095 | |
| 104 | S | B | -1.2386 | |
| 105 | R | B | -2.2202 | |
| 106 | P | B | -1.2112 | |
| 107 | G | B | -0.7209 | |
| 108 | S | B | -0.9482 | |
| 109 | V | B | 0.0000 | |
| 110 | E | B | 0.3754 | |
| 111 | L | B | 0.0000 | |
| 112 | V | B | 1.4334 | |
| 113 | L | B | 0.0000 | |
| 114 | A | B | 0.6884 | |
| 115 | G | B | 0.0000 | |
| 116 | A | B | 0.0000 | |
| 117 | T | B | 0.0000 | |
| 118 | S | B | 0.0000 | |
| 119 | G | B | -0.2112 | |
| 120 | Y | B | -0.1861 | |
| 121 | L | B | 0.0000 | |
| 122 | K | B | 0.0000 | |
| 123 | G | B | 0.0000 | |
| 124 | N | B | -0.4637 | |
| 125 | S | B | 0.0000 | |
| 126 | A | B | 0.0000 | |
| 127 | A | B | 0.0000 | |
| 128 | F | B | 0.0000 | |
| 129 | N | B | 0.0000 | |
| 130 | L | B | 0.0000 | |
| 131 | V | B | 0.0000 | |
| 132 | G | B | 0.0000 | |
| 133 | L | B | 0.0000 | |
| 134 | F | B | 0.0000 | |
| 135 | G | B | 0.0000 | |
| 136 | R | B | 0.0000 | |
| 137 | D | B | -1.5475 | |
| 138 | E | B | -1.4837 | |
| 139 | T | B | -1.0211 | |
| 140 | A | B | -0.3130 | |
| 141 | V | B | 0.0601 | |
| 142 | A | B | -0.2421 | |
| 143 | A | B | -0.6584 | |
| 144 | D | B | -1.6406 | |
| 145 | D | B | 0.0000 | |
| 146 | I | B | 0.0000 | |
| 147 | P | B | 0.0000 | |
| 148 | N | B | 0.0000 | |
| 149 | V | B | 0.0000 | |
| 150 | S | B | -0.1206 | |
| 151 | L | B | 0.0000 | |
| 152 | S | B | -0.2535 | |
| 153 | Q | B | -0.3280 | |
| 154 | A | B | 0.0000 | |
| 155 | V | B | 0.0000 | |
| 156 | V | B | 0.0000 | |
| 157 | E | B | 0.0000 | |
| 158 | L | B | 0.0000 | |
| 159 | Y | B | 0.0000 | |
| 160 | T | B | 0.0000 | |
| 161 | D | B | -1.4496 | |
| 162 | T | B | -0.5626 | |
| 163 | A | B | -0.1158 | |
| 164 | F | B | 1.2833 | |
| 165 | A | B | 0.2087 | |
| 166 | T | B | 0.2140 | |
| 167 | E | B | -0.3787 | |
| 168 | I | B | 1.8564 | |
| 169 | E | B | 1.0921 | |
| 170 | V | B | 1.6299 | |
| 171 | G | B | -0.0174 | |
| 172 | T | B | -0.8542 | |
| 173 | Y | B | 0.0000 | |
| 174 | S | B | -0.4482 | |
| 175 | V | B | 0.0820 | |
| 176 | T | B | -0.1869 | |
| 177 | G | B | -0.8147 | |
| 178 | D | B | -1.2932 | |
| 179 | V | B | -0.1133 | |
| 180 | I | B | 0.0000 | |
| 181 | E | B | -1.5482 | |
| 182 | L | B | 0.0000 | |
| 183 | E | B | -2.2679 | |
| 184 | L | B | 0.0000 | |
| 185 | S | B | -0.9901 | |
| 186 | T | B | 0.0000 | |
| 187 | R | B | -2.7182 | |
| 188 | D | B | 0.0000 | |
| 189 | Q | B | -2.1110 | |
| 190 | S | B | 0.0000 | |
| 191 | K | B | -2.2859 | |
| 192 | P | B | 0.0000 | |
| 193 | K | B | -2.2255 | |
| 194 | V | B | 0.0000 | |
| 195 | E | B | -2.2331 | |
| 196 | E | B | 0.0000 | |
| 197 | L | B | 0.0000 | |
| 198 | N | B | 0.0000 | |
| 199 | V | B | 0.0000 | |
| 200 | L | B | 0.0000 | |
| 201 | C | B | 0.0000 | |
| 202 | N | B | 0.0000 | |
| 203 | A | B | 0.0000 | |
| 204 | A | B | 0.0000 | |
| 205 | E | B | 0.0000 | |
| 206 | F | B | 0.0000 | |
| 207 | T | B | 0.0000 | |
| 208 | I | B | -1.2099 | |
| 209 | N | B | -2.5695 | |
| 210 | K | B | -3.2876 | |
| 211 | P | B | 0.0000 | |
| 212 | K | B | -3.2103 | |
| 213 | G | B | 0.0000 | |
| 214 | Y | B | 0.0000 | |
| 215 | V | B | -1.2413 | |
| 216 | G | B | -1.0920 | |
| 217 | Q | B | -1.3241 | |
| 218 | E | B | -2.1090 | |
| 219 | F | B | -1.4508 | |
| 220 | P | B | -0.9506 | |
| 221 | L | B | -0.8548 | |
| 222 | N | B | -1.2192 | |
| 223 | I | B | -0.1206 | |
| 224 | K | B | -0.6303 | |
| 225 | A | B | 0.0000 | |
| 226 | G | B | -0.3071 | |
| 227 | T | B | 0.2277 | |
| 228 | V | B | 1.2992 | |
| 229 | S | B | 0.3898 | |
| 230 | A | B | -0.6262 | |
| 231 | T | B | -1.4214 | |
| 232 | D | B | -2.4645 | |
| 233 | T | B | -2.2599 | |
| 234 | K | B | -2.8725 | |
| 235 | D | B | -2.7081 | |
| 236 | A | B | 0.0000 | |
| 237 | S | B | -2.3505 | |
| 238 | I | B | 0.0000 | |
| 239 | D | B | -2.2317 | |
| 240 | Y | B | 0.0000 | |
| 241 | H | B | -1.8074 | |
| 242 | E | B | 0.0000 | |
| 243 | D | B | -2.3754 | |
| 244 | R | B | 0.0000 | |
| 245 | S | B | -1.3320 | |
| 246 | Y | B | 0.0000 | |
| 247 | R | B | -1.8148 | |
| 248 | I | B | 0.0000 | |
| 249 | D | B | -2.0319 | |
| 250 | G | B | -1.1180 | |
| 251 | D | B | -1.3266 | |
| 252 | E | B | -1.1962 | |
| 253 | L | B | 0.0000 | |
| 254 | S | B | -0.3811 | |
| 255 | Y | B | 0.0000 | |
| 256 | S | B | -0.7893 | |
| 257 | L | B | 0.0000 | |
| 258 | Q | B | -2.3105 | |
| 259 | M | B | -1.2783 | |
| 260 | A | B | 0.0000 | |
| 261 | S | B | -1.2389 | |
| 262 | F | B | 0.0000 | |
| 263 | D | B | -1.9626 | |
| 264 | A | B | 0.0000 | |
| 265 | D | B | -2.1022 | |
| 266 | T | B | -1.0946 | |
| 267 | I | B | 0.0000 | |
| 268 | R | B | 0.0000 | |
| 269 | I | B | 0.0000 | |
| 270 | A | B | -0.4138 | |
| 271 | Q | B | 0.0000 | |
| 272 | P | B | -0.0268 | |
| 273 | K | B | -0.1725 | |
| 274 | L | B | 0.0305 | |
| 275 | E | B | -1.1550 | |
| 276 | T | B | -0.8286 | |
| 277 | S | B | -0.5791 | |
| 278 | I | B | -0.4266 | |
| 279 | L | B | 0.0000 | |
| 280 | K | B | -1.1269 | |
| 281 | M | B | 0.0000 | |
| 282 | T | B | -0.2697 | |
| 283 | T | B | 0.0138 | |
| 284 | W | B | 0.0107 | |
| 285 | N | B | 0.0000 | |
| 286 | P | B | 0.0000 | |
| 287 | T | B | 0.0000 | |
| 288 | I | B | 0.0000 | |
| 289 | S | B | 0.0000 | |
| 290 | G | B | -0.4623 | |
| 291 | S | B | -0.8514 | |
| 292 | G | B | -0.5062 | |
| 293 | I | B | 0.3563 | |
| 294 | D | B | 0.0000 | |
| 295 | V | B | -0.2496 | |
| 296 | D | B | -1.1871 | |
| 297 | T | B | -1.2233 | |
| 298 | K | B | -1.3764 | |
| 299 | I | B | 0.0000 | |
| 300 | T | B | 0.0000 | |
| 301 | D | B | -0.4905 | |
| 302 | T | B | 0.0000 | |
| 303 | L | B | 0.0000 | |
| 304 | Q | B | 0.0828 | |
| 305 | I | B | 0.3358 | |
| 306 | V | B | 0.0000 | |
| 307 | S | B | 0.0000 | |
| 308 | L | B | 0.0000 | |
| 309 | Q | B | 0.0000 | |
| 310 | L | B | 0.0000 | |
| 311 | N | B | 0.0000 | |
| 312 | K | B | -1.7899 | |
| 313 | M | B | 0.0000 | |
| 314 | K | B | -1.6749 | |
| 315 | S | B | 0.0000 | |
| 316 | R | B | -2.0451 | |
| 317 | D | B | -2.4742 | |
| 318 | L | B | 0.0000 | |
| 319 | A | B | -0.4381 | |
| 320 | A | B | 0.0000 | |
| 321 | V | B | 1.0162 | |
| 322 | L | B | 0.0000 | |
| 323 | H | B | -0.5121 | |
| 324 | R | B | -1.2119 | |
| 325 | Q | B | 0.0000 | |
| 326 | R | B | -2.7690 | |
| 1 | S | C | -0.8276 | |
| 2 | P | C | -0.7552 | |
| 3 | A | C | -1.0273 | |
| 4 | L | C | 0.0000 | |
| 5 | Q | C | -1.3813 | |
| 6 | A | C | -0.7408 | |
| 7 | L | C | 0.0000 | |
| 8 | S | C | -0.4688 | |
| 9 | P | C | -0.4008 | |
| 10 | L | C | 0.0000 | |
| 11 | L | C | -0.1540 | |
| 12 | G | C | 0.0000 | |
| 13 | S | C | 0.0000 | |
| 14 | W | C | 0.0000 | |
| 15 | A | C | 0.0187 | |
| 16 | G | C | 0.0794 | |
| 17 | R | C | 0.0545 | |
| 18 | G | C | 0.1102 | |
| 19 | A | C | 0.0308 | |
| 20 | I | C | -0.0215 | |
| 21 | D | C | -0.9790 | |
| 22 | E | C | -1.0785 | |
| 23 | E | C | -0.6890 | |
| 24 | Y | C | 0.0000 | |
| 25 | L | C | 0.0769 | |
| 26 | E | C | 0.0000 | |
| 27 | E | C | -0.2494 | |
| 28 | V | C | 0.0000 | |
| 29 | V | C | 0.0000 | |
| 30 | F | C | 0.0000 | |
| 31 | A | C | -0.4491 | |
| 32 | H | C | -1.0405 | |
| 33 | V | C | -1.0661 | |
| 34 | G | C | -1.2731 | |
| 35 | K | C | -1.8255 | |
| 36 | P | C | -1.3022 | |
| 37 | F | C | -0.6540 | |
| 38 | L | C | 0.0000 | |
| 39 | T | C | 0.0000 | |
| 40 | Y | C | 0.0000 | |
| 41 | T | C | -0.0111 | |
| 42 | Q | C | 0.0000 | |
| 43 | Q | C | 0.0000 | |
| 44 | T | C | 0.0000 | |
| 45 | R | C | -0.3055 | |
| 46 | F | C | 0.0000 | |
| 47 | D | C | -0.6737 | |
| 48 | R | C | -1.0516 | |
| 49 | V | C | 0.0000 | |
| 50 | L | C | 0.0000 | |
| 51 | K | C | -2.1459 | |
| 52 | T | C | 0.0000 | |
| 53 | D | C | -1.8899 | |
| 54 | V | C | -1.3605 | |
| 55 | N | C | -2.3610 | |
| 56 | K | C | -2.8186 | |
| 57 | Q | C | -3.2487 | |
| 58 | F | C | 0.0000 | |
| 59 | E | C | -2.5150 | |
| 60 | M | C | 0.0000 | |
| 61 | G | C | 0.0000 | |
| 62 | A | C | -0.3665 | |
| 63 | A | C | -0.0249 | |
| 64 | P | C | -0.2753 | |
| 65 | T | C | -0.3788 | |
| 66 | G | C | -0.7889 | |
| 67 | D | C | -1.3203 | |
| 68 | A | C | -1.2478 | |
| 69 | D | C | -2.0734 | |
| 70 | L | C | -1.0326 | |
| 71 | T | C | -0.7582 | |
| 72 | T | C | -0.4471 | |
| 73 | A | C | -0.4691 | |
| 74 | P | C | -0.2956 | |
| 75 | T | C | -0.1963 | |
| 76 | P | C | -0.6626 | |
| 77 | A | C | -1.0763 | |
| 78 | S | C | -1.8574 | |
| 79 | R | C | -2.3216 | |
| 80 | E | C | -3.0615 | |
| 81 | N | C | 0.0000 | |
| 82 | P | C | -0.8832 | |
| 83 | A | C | 0.0000 | |
| 84 | Y | C | -0.8253 | |
| 85 | G | C | -1.0040 | |
| 86 | K | C | -1.4764 | |
| 87 | H | C | -2.0576 | |
| 88 | M | C | 0.0000 | |
| 89 | Q | C | 0.0000 | |
| 90 | D | C | -0.6771 | |
| 91 | A | C | 0.0000 | |
| 92 | E | C | -0.6991 | |
| 93 | M | C | 0.0000 | |
| 94 | L | C | -0.0484 | |
| 95 | H | C | 0.0000 | |
| 96 | S | C | 0.1220 | |
| 97 | E | C | 0.0000 | |
| 98 | T | C | 0.3754 | |
| 99 | G | C | 0.7078 | |
| 100 | Y | C | 1.0821 | |
| 101 | L | C | 0.0000 | |
| 102 | R | C | -1.0853 | |
| 103 | V | C | -1.0297 | |
| 104 | S | C | -1.2292 | |
| 105 | R | C | -2.2175 | |
| 106 | P | C | -1.2007 | |
| 107 | G | C | -0.6979 | |
| 108 | S | C | -0.9361 | |
| 109 | V | C | 0.0000 | |
| 110 | E | C | 0.4114 | |
| 111 | L | C | 0.0000 | |
| 112 | V | C | 1.5852 | |
| 113 | L | C | 0.0000 | |
| 114 | A | C | 0.8249 | |
| 115 | G | C | 0.0000 | |
| 116 | A | C | 0.0000 | |
| 117 | T | C | 0.0000 | |
| 118 | S | C | 0.0000 | |
| 119 | G | C | 0.0000 | |
| 120 | Y | C | -0.1940 | |
| 121 | L | C | 0.0000 | |
| 122 | K | C | 0.0000 | |
| 123 | G | C | 0.0000 | |
| 124 | N | C | -0.6127 | |
| 125 | S | C | 0.0000 | |
| 126 | A | C | 0.0000 | |
| 127 | A | C | 0.0000 | |
| 128 | F | C | 0.0000 | |
| 129 | N | C | 0.0000 | |
| 130 | L | C | 0.0000 | |
| 131 | V | C | 0.0000 | |
| 132 | G | C | 0.0000 | |
| 133 | L | C | 0.0000 | |
| 134 | F | C | 0.0000 | |
| 135 | G | C | 0.0000 | |
| 136 | R | C | 0.0000 | |
| 137 | D | C | -1.5960 | |
| 138 | E | C | -1.3319 | |
| 139 | T | C | -0.8552 | |
| 140 | A | C | -0.2601 | |
| 141 | V | C | 0.0213 | |
| 142 | A | C | -0.2926 | |
| 143 | A | C | -0.7730 | |
| 144 | D | C | -1.6960 | |
| 145 | D | C | 0.0000 | |
| 146 | I | C | 0.0000 | |
| 147 | P | C | 0.0000 | |
| 148 | N | C | 0.0000 | |
| 149 | V | C | 0.0000 | |
| 150 | S | C | -0.1202 | |
| 151 | L | C | 0.0000 | |
| 152 | S | C | -0.2418 | |
| 153 | Q | C | -0.2827 | |
| 154 | A | C | 0.0000 | |
| 155 | V | C | 0.0000 | |
| 156 | V | C | 0.0000 | |
| 157 | E | C | 0.0000 | |
| 158 | L | C | 0.0000 | |
| 159 | Y | C | 0.0000 | |
| 160 | T | C | 0.0000 | |
| 161 | D | C | -1.4077 | |
| 162 | T | C | -0.4592 | |
| 163 | A | C | -0.0395 | |
| 164 | F | C | 1.4393 | |
| 165 | A | C | 0.3415 | |
| 166 | T | C | 0.3957 | |
| 167 | E | C | -0.0516 | |
| 168 | I | C | 2.0585 | |
| 169 | E | C | 1.1841 | |
| 170 | V | C | 1.6368 | |
| 171 | G | C | -0.1188 | |
| 172 | T | C | -1.0385 | |
| 173 | Y | C | 0.0000 | |
| 174 | S | C | -0.5191 | |
| 175 | V | C | 0.0745 | |
| 176 | T | C | -0.1545 | |
| 177 | G | C | -0.7023 | |
| 178 | D | C | -1.1315 | |
| 179 | V | C | 0.1104 | |
| 180 | I | C | 0.0000 | |
| 181 | E | C | -2.2462 | |
| 182 | L | C | 0.0000 | |
| 183 | E | C | -2.7335 | |
| 184 | L | C | 0.0000 | |
| 185 | S | C | -1.1053 | |
| 186 | T | C | 0.0000 | |
| 187 | R | C | -2.6081 | |
| 188 | D | C | 0.0000 | |
| 189 | Q | C | -1.9188 | |
| 190 | S | C | 0.0000 | |
| 191 | K | C | -2.2678 | |
| 192 | P | C | 0.0000 | |
| 193 | K | C | -2.4911 | |
| 194 | V | C | 0.0000 | |
| 195 | E | C | -2.0272 | |
| 196 | E | C | 0.0000 | |
| 197 | L | C | 0.0000 | |
| 198 | N | C | 0.0000 | |
| 199 | V | C | 0.0000 | |
| 200 | L | C | 0.0000 | |
| 201 | C | C | 0.0000 | |
| 202 | N | C | 0.0000 | |
| 203 | A | C | 0.0000 | |
| 204 | A | C | 0.0000 | |
| 205 | E | C | 0.0000 | |
| 206 | F | C | 0.0000 | |
| 207 | T | C | 0.0000 | |
| 208 | I | C | -0.9221 | |
| 209 | N | C | -2.0439 | |
| 210 | K | C | -3.1531 | |
| 211 | P | C | 0.0000 | |
| 212 | K | C | -2.9249 | |
| 213 | G | C | 0.0000 | |
| 214 | Y | C | 0.0000 | |
| 215 | V | C | -1.2116 | |
| 216 | G | C | -1.0550 | |
| 217 | Q | C | -1.3048 | |
| 218 | E | C | -2.0899 | |
| 219 | F | C | -1.4472 | |
| 220 | P | C | -1.0065 | |
| 221 | L | C | -0.9259 | |
| 222 | N | C | -1.3468 | |
| 223 | I | C | -0.4285 | |
| 224 | K | C | -0.7664 | |
| 225 | A | C | 0.0000 | |
| 226 | G | C | -0.2889 | |
| 227 | T | C | 0.0000 | |
| 228 | V | C | 1.2901 | |
| 229 | S | C | 0.3720 | |
| 230 | A | C | -0.5701 | |
| 231 | T | C | -1.3370 | |
| 232 | D | C | -2.3649 | |
| 233 | T | C | -2.2812 | |
| 234 | K | C | -3.1849 | |
| 235 | D | C | -3.5686 | |
| 236 | A | C | 0.0000 | |
| 237 | S | C | -2.5664 | |
| 238 | I | C | 0.0000 | |
| 239 | D | C | -2.1763 | |
| 240 | Y | C | 0.0000 | |
| 241 | H | C | -1.7102 | |
| 242 | E | C | 0.0000 | |
| 243 | D | C | -2.2526 | |
| 244 | R | C | 0.0000 | |
| 245 | S | C | -1.5043 | |
| 246 | Y | C | 0.0000 | |
| 247 | R | C | -2.7769 | |
| 248 | I | C | 0.0000 | |
| 249 | D | C | -2.3742 | |
| 250 | G | C | -1.2290 | |
| 251 | D | C | -1.3457 | |
| 252 | E | C | -1.3734 | |
| 253 | L | C | 0.0000 | |
| 254 | S | C | -0.5212 | |
| 255 | Y | C | 0.0000 | |
| 256 | S | C | -0.8043 | |
| 257 | L | C | 0.0000 | |
| 258 | Q | C | -2.2002 | |
| 259 | M | C | -1.1441 | |
| 260 | A | C | 0.0000 | |
| 261 | S | C | -1.1235 | |
| 262 | F | C | 0.0000 | |
| 263 | D | C | -1.9116 | |
| 264 | A | C | 0.0000 | |
| 265 | D | C | -2.0648 | |
| 266 | T | C | -1.0566 | |
| 267 | I | C | 0.0000 | |
| 268 | R | C | 0.0000 | |
| 269 | I | C | 0.0000 | |
| 270 | A | C | -0.3111 | |
| 271 | Q | C | 0.0000 | |
| 272 | P | C | -0.1070 | |
| 273 | K | C | -0.3362 | |
| 274 | L | C | -0.0509 | |
| 275 | E | C | -1.1228 | |
| 276 | T | C | -0.8188 | |
| 277 | S | C | -0.6366 | |
| 278 | I | C | -0.4065 | |
| 279 | L | C | 0.0000 | |
| 280 | K | C | -1.2224 | |
| 281 | M | C | 0.0000 | |
| 282 | T | C | -0.3773 | |
| 283 | T | C | -0.1278 | |
| 284 | W | C | 0.0000 | |
| 285 | N | C | 0.0000 | |
| 286 | P | C | 0.0000 | |
| 287 | T | C | 0.0000 | |
| 288 | I | C | 0.0000 | |
| 289 | S | C | 0.0000 | |
| 290 | G | C | -0.2659 | |
| 291 | S | C | -0.6769 | |
| 292 | G | C | -0.3232 | |
| 293 | I | C | 0.5325 | |
| 294 | D | C | 0.0000 | |
| 295 | V | C | 0.0682 | |
| 296 | D | C | -0.6868 | |
| 297 | T | C | -0.9576 | |
| 298 | K | C | -1.1163 | |
| 299 | I | C | 0.0000 | |
| 300 | T | C | 0.0000 | |
| 301 | D | C | -0.5127 | |
| 302 | T | C | 0.0000 | |
| 303 | L | C | 0.0000 | |
| 304 | Q | C | 0.0384 | |
| 305 | I | C | 0.2763 | |
| 306 | V | C | 0.0000 | |
| 307 | S | C | 0.0000 | |
| 308 | L | C | 0.0000 | |
| 309 | Q | C | 0.0000 | |
| 310 | L | C | 0.0000 | |
| 311 | N | C | 0.0000 | |
| 312 | K | C | -1.6712 | |
| 313 | M | C | 0.0000 | |
| 314 | K | C | -1.5717 | |
| 315 | S | C | 0.0000 | |
| 316 | R | C | -1.8817 | |
| 317 | D | C | -2.2975 | |
| 318 | L | C | 0.0000 | |
| 319 | A | C | -0.3207 | |
| 320 | A | C | 0.0000 | |
| 321 | V | C | 1.2977 | |
| 322 | L | C | 0.0000 | |
| 323 | H | C | -0.4825 | |
| 324 | R | C | -1.2831 | |
| 325 | Q | C | 0.0000 | |
| 326 | R | C | -2.7673 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| AR114A | -1.4369 | -0.0092 | View | CSV | PDB |
| VR170A | -0.4837 | -0.0158 | View | CSV | PDB |
| VR170C | -0.5518 | -0.0128 | View | CSV | PDB |
| IR168C | -0.5953 | -0.0098 | View | CSV | PDB |
| VR321A | -1.6155 | -0.004 | View | CSV | PDB |
| VK170C | -0.2906 | -0.008 | View | CSV | PDB |
| YR100A | -0.4538 | -0.0065 | View | CSV | PDB |
| VK170A | -0.2698 | -0.008 | View | CSV | PDB |
| VD321C | -0.1578 | -0.0077 | View | CSV | PDB |
| IR168A | -0.3853 | -0.0054 | View | CSV | PDB |
| VR321C | -0.2488 | -0.0063 | View | CSV | PDB |
| YR100C | -0.813 | -0.0034 | View | CSV | PDB |
| YR100B | -1.1302 | -0.0025 | View | CSV | PDB |
| AR114C | -1.3307 | -0.0021 | View | CSV | PDB |
| VR112B | -0.0117 | -0.0068 | View | CSV | PDB |
| VK321A | -0.0306 | -0.0058 | View | CSV | PDB |
| VR321B | -0.3592 | -0.0032 | View | CSV | PDB |
| AE114A | -0.5804 | -0.0024 | View | CSV | PDB |
| VK112C | -0.0619 | -0.0034 | View | CSV | PDB |
| VK321B | -0.3514 | -0.0011 | View | CSV | PDB |
| IK168C | 0.2716 | -0.0087 | View | CSV | PDB |
| VR112A | 0.3135 | -0.0097 | View | CSV | PDB |
| VE112A | 0.4596 | -0.013 | View | CSV | PDB |
| VR112C | 0.4002 | -0.0105 | View | CSV | PDB |
| IK168A | 0.6045 | -0.007 | View | CSV | PDB |
| VE112B | 0.374 | -0.0023 | View | CSV | PDB |
| YD100A | 2.5989 | -0.004 | View | CSV | PDB |
| YE100B | 1.5787 | -0.0015 | View | CSV | PDB |
| YD100C | 2.2969 | -0.0003 | View | CSV | PDB |
| AK114C | -1.1658 | 0.0013 | View | CSV | PDB |
ALA alanine
ARG arginine
ASN asparagine
ASP aspartic acid
CYS cysteine
GLN glutamine
GLU glutamic acid
GLY glycine
HIS histidine
ILE isoleucine
LEU leucine
LYS lysine
MET methionine
PHE phenylalanine
PRO proline
SER serine
THR threonine
TRP tryptophan
TYR tyrosine
VAL valine