Project name: query_structure

Status: done

Started: 2026-03-17 00:10:02
Settings
Chain sequence(s) A: MGSSHHHHHHYYLEVDNKFNKEFQWAWQEILHLPNLNKYQKEAFKTSLKDDPSQSANLLAEAKKLNDAQAPKVD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:28)
Show buried residues

Minimal score value
-3.2988
Maximal score value
1.9053
Average score
-1.2954
Total score value
-95.859

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7762
2 G A -0.0969
3 S A -0.5429
4 S A -1.2425
5 H A -2.0058
6 H A -2.4056
7 H A -2.5725
8 H A -2.4001
9 H A -1.8131
10 H A -0.6676
11 Y A 1.2121
12 Y A 1.9053
13 L A 1.5292
14 E A -0.7746
15 V A -0.1739
16 D A -2.3071
17 N A -2.5386
18 K A -2.6457
19 F A -0.7761
20 N A -2.3730
21 K A -2.8487
22 E A -2.2197
23 F A -1.6432
24 Q A -1.1791
25 W A -0.6154
26 A A 0.0000
27 W A -0.8771
28 Q A -0.6433
29 E A -0.9577
30 I A 0.0000
31 L A -0.8356
32 H A -1.0994
33 L A 0.0000
34 P A -1.1770
35 N A -1.5601
36 L A 0.0000
37 N A -1.7351
38 K A -2.0557
39 Y A -0.6160
40 Q A -1.0451
41 K A -1.7066
42 E A -1.9920
43 A A -1.2122
44 F A 0.0000
45 K A -1.4618
46 T A -1.9018
47 S A -1.9479
48 L A 0.0000
49 K A -2.9677
50 D A -3.1799
51 D A -2.4129
52 P A -1.9998
53 S A -1.2533
54 Q A -1.7572
55 S A 0.0000
56 A A -1.1715
57 N A -1.9829
58 L A -1.6703
59 L A 0.0000
60 A A -2.0032
61 E A -3.0503
62 A A 0.0000
63 K A -3.0256
64 K A -3.2988
65 L A -2.0534
66 N A 0.0000
67 D A -3.1679
68 A A -1.8421
69 Q A -1.8267
70 A A -1.4580
71 P A -1.2198
72 K A -1.7714
73 V A 0.0081
74 D A -1.5107
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018