Project name: query_structure

Status: done

Started: 2026-03-17 01:28:36
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYVITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAYSDQVEYYEYFYGSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:22)
Show buried residues

Minimal score value
-2.7027
Maximal score value
2.3658
Average score
-0.3431
Total score value
-32.9389

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7841
2 S A 0.7281
3 S A 0.9788
4 V A 0.3159
5 P A 0.0000
6 T A -1.7003
7 K A -2.6621
8 L A 0.0000
9 E A -1.9321
10 V A 0.1010
11 V A 1.5379
12 A A 0.8979
13 A A 0.2989
14 T A -0.3406
15 P A -1.1186
16 T A -0.9951
17 S A -0.5286
18 L A 0.0000
19 L A 0.7555
20 I A 0.0000
21 S A -0.9869
22 W A 0.0000
23 D A -2.7027
24 A A -1.2521
25 P A -0.0294
26 A A 0.4355
27 V A 0.4726
28 T A -0.1749
29 V A -0.0619
30 V A 0.1229
31 Y A 0.1195
32 Y A 0.0000
33 V A 0.1857
34 I A 0.0000
35 T A -0.3724
36 Y A -0.2905
37 G A 0.0000
38 E A -1.5479
39 T A -1.2631
40 G A -1.2411
41 G A -1.4277
42 N A -1.5369
43 S A -0.8319
44 P A -0.3153
45 V A 0.4443
46 Q A -0.8282
47 E A -1.4866
48 F A -0.4768
49 T A -0.0603
50 V A 0.0000
51 P A -0.4691
52 G A -0.3102
53 S A -0.8996
54 K A -1.9121
55 S A -1.4114
56 T A -0.7634
57 A A 0.0000
58 T A 0.2425
59 I A 0.0000
60 S A -0.6569
61 G A -1.0282
62 L A 0.0000
63 K A -2.3608
64 P A -1.6477
65 G A -1.4450
66 V A -1.4056
67 D A -2.1010
68 Y A 0.0000
69 T A -0.7935
70 I A 0.0000
71 T A -0.0454
72 V A 0.0000
73 Y A 0.7189
74 A A 0.0000
75 Y A 0.0000
76 S A 0.3355
77 D A -1.2588
78 Q A -0.9144
79 V A 0.2490
80 E A -0.7590
81 Y A 1.0605
82 Y A 1.3057
83 E A 0.3097
84 Y A 1.7481
85 F A 2.3028
86 Y A 2.3658
87 G A 1.3757
88 S A 0.4702
89 P A 0.3288
90 I A 0.0840
91 S A -0.5230
92 I A -0.7230
93 N A -1.7458
94 Y A -1.4987
95 R A -2.5374
96 T A -1.6407
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018