Project name: lanm_C7

Chain sequence(s)	A: APTTTTKVDIAAFDPDKDGTIELKEALAAGSAAFDKLDPDKDGTLEAKELKGRVSEADLKKLDPDNDGTLEKKEYLAAVEAQFKAANPDNDGTIEARELASPAGSALVNLIR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -4.0206
• Maximal score value: 0.0
• Average score: -1.5175
• Total score value: -169.9645

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.0977
2	P	A	-0.2973
3	T	A	-0.2458
4	T	A	-0.5124
5	T	A	-0.7017
6	T	A	-1.1071
7	K	A	-2.2608
8	V	A	-1.4943
9	D	A	-1.9151
10	I	A	-1.3631
11	A	A	-1.2748
12	A	A	-0.7423
13	F	A	-0.8215
14	D	A	0.0000
15	P	A	-1.8916
16	D	A	-3.2972
17	K	A	-3.5541
18	D	A	-3.5117
19	G	A	-2.3189
20	T	A	-1.7777
21	I	A	0.0000
22	E	A	-1.3647
23	L	A	-0.9429
24	K	A	-1.5883
25	E	A	0.0000
26	A	A	0.0000
27	L	A	-0.1616
28	A	A	-0.1318
29	A	A	-0.4733
30	G	A	0.0000
31	S	A	-0.6323
32	A	A	-0.9255
33	A	A	0.0000
34	F	A	0.0000
35	D	A	-2.7016
36	K	A	-2.8171
37	L	A	-2.0761
38	D	A	0.0000
39	P	A	-2.6160
40	D	A	-3.6293
41	K	A	-4.0206
42	D	A	-3.5763
43	G	A	-2.8238
44	T	A	-2.4894
45	L	A	0.0000
46	E	A	-1.9467
47	A	A	-2.3590
48	K	A	-2.8444
49	E	A	-2.0930
50	L	A	0.0000
51	K	A	-3.0249
52	G	A	-1.9872
53	R	A	-1.7411
54	V	A	-1.5522
55	S	A	-2.1702
56	E	A	-3.2222
57	A	A	-2.1463
58	D	A	-2.5635
59	L	A	-2.8102
60	K	A	-3.9293
61	K	A	-3.3873
62	L	A	-2.1650
63	D	A	0.0000
64	P	A	-2.5478
65	D	A	-3.5436
66	N	A	-3.8067
67	D	A	-3.6127
68	G	A	-2.6210
69	T	A	-2.3394
70	L	A	0.0000
71	E	A	-2.6861
72	K	A	-2.2662
73	K	A	-2.4240
74	E	A	-1.7986
75	Y	A	0.0000
76	L	A	-0.7246
77	A	A	-0.6980
78	A	A	0.0000
79	V	A	0.0000
80	E	A	-1.0573
81	A	A	-0.8225
82	Q	A	-0.8728
83	F	A	0.0000
84	K	A	-2.5926
85	A	A	-1.4090
86	A	A	0.0000
87	N	A	0.0000
88	P	A	-2.2093
89	D	A	-3.3732
90	N	A	-3.5555
91	D	A	-3.3939
92	G	A	-2.4939
93	T	A	-2.0392
94	I	A	0.0000
95	E	A	-2.0965
96	A	A	-1.9226
97	R	A	-2.3961
98	E	A	-1.7717
99	L	A	0.0000
100	A	A	-1.3970
101	S	A	-0.6283
102	P	A	-0.3306
103	A	A	-0.5018
104	G	A	0.0000
105	S	A	-0.4577
106	A	A	-0.2931
107	L	A	0.0000
108	V	A	0.0000
109	N	A	-1.0740
110	L	A	0.0000
111	I	A	0.0000
112	R	A	-2.1090