Project name: 73fba65e8776997

Chain sequence(s)	A: TTVHQRTKTTCPDGQRDRGGCSGPYSCGGDNCCAYAAASVYRGYSCKDTYEWYVDTW
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:09)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:09)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:09)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:09)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)

• Minimal score value: -4.4223
• Maximal score value: 1.8016
• Average score: -1.0015
• Total score value: -57.0827

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	T	A	0.5318
2	T	A	0.7355
3	V	A	1.4963
4	H	A	-0.1839
5	Q	A	-1.3678
6	R	A	-2.5074
7	T	A	-1.8723
8	K	A	-2.4340
9	T	A	-2.1820
10	T	A	-2.3894
11	C	A	-2.7746
12	P	A	-2.1411
13	D	A	-2.3827
14	G	A	-1.5942
15	Q	A	-2.2805
16	R	A	-3.7471
17	D	A	-4.4223
18	R	A	-4.3766
19	G	A	-2.8711
20	G	A	-2.6996
21	C	A	0.0000
22	S	A	-0.8948
23	G	A	0.1898
24	P	A	0.3275
25	Y	A	0.9269
26	S	A	-0.4927
27	C	A	-1.2769
28	G	A	-1.7568
29	G	A	-1.6564
30	D	A	-2.6977
31	N	A	-3.5205
32	C	A	0.0000
33	C	A	0.0000
34	A	A	-0.9228
35	Y	A	0.7732
36	A	A	0.4356
37	A	A	0.4291
38	A	A	0.4396
39	S	A	0.5800
40	V	A	0.8448
41	Y	A	0.4614
42	R	A	-0.8949
43	G	A	-1.7200
44	Y	A	-0.8218
45	S	A	-0.8641
46	C	A	-2.2258
47	K	A	-2.6468
48	D	A	-2.7734
49	T	A	-1.6636
50	Y	A	-0.6257
51	E	A	-1.2762
52	W	A	0.5182
53	Y	A	1.0501
54	V	A	1.8016
55	D	A	0.6420
56	T	A	0.6116
57	W	A	1.0798