Project name: 741d981429c78d4

Chain sequence(s)	A: SFMLTQPPSVSGSPGRTVAISCTRTSGSIASGFVHWYQQRPASPPTLLIFENDHRSPGISERFSGSLDTSSNTATLTISGLKTEDEAHYHCQSFERMTWVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:55)

• Minimal score value: -2.4949
• Maximal score value: 1.6247
• Average score: -0.4873
• Total score value: -53.6022

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.2587
2	F	A	0.0000
3	M	A	1.0031
4	L	A	0.0000
5	T	A	0.0515
6	Q	A	0.0000
7	P	A	-0.4650
8	P	A	-0.7549
9	S	A	-0.7176
10	V	A	-0.2701
11	S	A	-0.0350
12	G	A	-0.2473
13	S	A	-0.3924
14	P	A	-1.0540
15	G	A	-1.8709
16	R	A	-2.4400
17	T	A	-1.3788
18	V	A	0.0000
19	A	A	-0.0165
20	I	A	0.0000
21	S	A	-0.1009
22	C	A	0.0000
23	T	A	-0.2553
24	R	A	-0.2171
25	T	A	-0.0979
26	S	A	-0.4161
27	G	A	-0.7711
28	S	A	-0.6497
29	I	A	0.0000
30	A	A	-0.0583
31	S	A	-0.2215
32	G	A	0.1732
33	F	A	0.9793
34	V	A	0.0000
35	H	A	-0.0261
36	W	A	0.0000
37	Y	A	0.0788
38	Q	A	0.0000
39	Q	A	-1.4338
40	R	A	-1.9969
41	P	A	-1.0918
42	A	A	-0.4680
43	S	A	-0.6830
44	P	A	-0.6180
45	P	A	-0.6340
46	T	A	-0.1664
47	L	A	0.3782
48	L	A	0.0000
49	I	A	0.0000
50	F	A	-0.6333
51	E	A	-1.1234
52	N	A	-1.2218
53	D	A	-2.4949
54	H	A	-2.3229
55	R	A	-1.9563
56	S	A	-0.7403
57	P	A	-0.8471
58	G	A	-0.7622
59	I	A	-0.5474
60	S	A	-1.1417
61	E	A	-2.1507
62	R	A	-1.2909
63	F	A	0.0000
64	S	A	-1.3621
65	G	A	-1.3008
66	S	A	-1.1302
67	L	A	-0.5380
68	D	A	-1.1462
69	T	A	-0.8094
70	S	A	-0.7264
71	S	A	-0.7579
72	N	A	-0.8720
73	T	A	-0.6468
74	A	A	0.0000
75	T	A	-0.4873
76	L	A	0.0000
77	T	A	-0.2242
78	I	A	0.0000
79	S	A	-1.3955
80	G	A	-1.5969
81	L	A	0.0000
82	K	A	-2.0832
83	T	A	-1.3979
84	E	A	-2.2116
85	D	A	0.0000
86	E	A	-2.1734
87	A	A	0.0000
88	H	A	-1.7314
89	Y	A	0.0000
90	H	A	-0.3140
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	F	A	0.9823
95	E	A	-0.2444
96	R	A	-1.1524
97	M	A	0.5075
98	T	A	0.6658
99	W	A	1.6247
100	V	A	1.4689
101	F	A	1.5524
102	G	A	0.3981
103	G	A	-0.3254
104	G	A	-0.7035
105	T	A	0.0000
106	K	A	-1.7794
107	L	A	0.0000
108	T	A	-0.4208
109	V	A	-0.1564
110	L	A	1.2615