Project name: 744a121af67e5c5

Status: done

Started: 2024-12-30 05:45:07
Settings
Chain sequence(s) A: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:07)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:07)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:07)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:07)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:56)
Show buried residues

Minimal score value
-4.2482
Maximal score value
2.1412
Average score
-0.7226
Total score value
-125.0076

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.9620
2 D A -0.2734
3 V A 1.4591
4 T A 0.9176
5 I A 1.5109
6 Q A -0.3651
7 H A -0.2000
8 P A -0.1091
9 W A 0.1469
10 F A -0.4791
11 K A -1.2934
12 R A -1.7289
13 T A -0.2921
14 L A 0.2844
15 G A -0.0285
16 P A 0.4625
17 F A 1.9673
18 Y A 1.0312
19 P A 0.0670
20 S A -0.5737
21 R A -1.9895
22 L A -0.1212
23 F A 0.4650
24 D A -0.6847
25 Q A 0.0000
26 F A 0.0000
27 F A 0.6901
28 G A -0.2424
29 E A -1.4047
30 G A -0.6180
31 L A 1.3430
32 F A 1.4605
33 E A -0.5782
34 Y A 0.6159
35 D A -0.3168
36 L A 1.2285
37 L A 1.2536
38 P A 1.1150
39 F A 2.1412
40 L A 0.7665
41 S A 0.6057
42 S A 0.8676
43 T A 1.1086
44 I A 1.8878
45 S A 1.1899
46 P A 0.8277
47 Y A 0.4185
48 Y A 0.2998
49 R A -0.2905
50 Q A -0.7914
51 S A 0.0000
52 L A 0.6639
53 F A 0.9597
54 R A 0.0862
55 T A 0.2478
56 V A 1.3185
57 L A 0.1711
58 D A -1.2116
59 S A -0.8393
60 G A -0.4054
61 I A 1.1685
62 S A -0.3950
63 E A -1.6398
64 V A 0.0000
65 R A -1.8229
66 S A -2.1244
67 D A -3.0617
68 R A -3.2434
69 D A -1.9591
70 K A -1.7394
71 F A 0.0000
72 V A -0.0015
73 I A 0.0000
74 F A -0.4415
75 L A 0.0000
76 D A -2.5644
77 V A 0.0000
78 K A -2.5069
79 H A -2.4767
80 F A 0.0000
81 S A 0.0000
82 P A 0.0000
83 E A -2.1256
84 D A 0.0000
85 L A 0.0000
86 T A -0.9868
87 V A 0.0000
88 K A -1.9661
89 V A 0.0000
90 Q A -2.8973
91 D A -3.2769
92 D A -3.1929
93 F A -1.6189
94 V A 0.0000
95 E A -2.0592
96 I A 0.0000
97 H A -2.2729
98 G A 0.0000
99 K A -3.3836
100 H A -2.8018
101 N A -2.7861
102 E A -2.8584
103 R A -3.1605
104 Q A -3.5271
105 D A -3.8879
106 D A -3.4723
107 H A -2.1956
108 G A -0.6601
109 Y A 0.5918
110 I A 1.5165
111 S A -0.7864
112 R A -1.9865
113 E A -2.9747
114 F A -2.0830
115 H A -2.3317
116 R A -1.7181
117 R A -1.9501
118 Y A -0.7676
119 R A -1.0716
120 L A -0.2821
121 P A -0.2426
122 S A -0.6059
123 N A 0.0000
124 V A 0.0000
125 D A -0.8394
126 Q A 0.0000
127 S A -0.6144
128 A A -0.3135
129 L A -0.2870
130 S A -0.3540
131 C A 0.0000
132 S A -1.0130
133 L A -0.5568
134 S A -0.0257
135 A A -0.3381
136 D A -1.7756
137 G A -1.4052
138 M A 0.0000
139 L A 0.0000
140 T A 0.0159
141 F A 0.0000
142 C A -0.2342
143 G A 0.0000
144 P A -0.7869
145 K A -1.2129
146 I A 0.3883
147 Q A -0.7863
148 T A -0.4866
149 G A -0.2887
150 L A 0.2644
151 D A -1.4304
152 A A -0.6255
153 T A -0.6868
154 H A -2.1054
155 A A -2.1229
156 E A -3.2006
157 R A -2.4931
158 A A -1.3132
159 I A -0.5363
160 P A -0.6860
161 V A -0.7916
162 S A -1.8888
163 R A -3.7150
164 E A -4.1022
165 E A -4.2482
166 K A -3.5186
167 P A -1.7711
168 T A -1.1111
169 S A -1.7390
170 A A -0.8782
171 P A -1.1142
172 S A -1.6797
173 S A -1.6738
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018