Project name: 7488ca32c5b3d22

Chain sequence(s)	A: DNGNLWTFIGKAIGSTARSWAEGAMFAPAIGPAKEIVDKLNGN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:24)

• Minimal score value: -2.7108
• Maximal score value: 2.5952
• Average score: -0.2144
• Total score value: -9.2178

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-2.7108
2	N	A	-2.2354
3	G	A	-1.0225
4	N	A	-0.8655
5	L	A	0.9264
6	W	A	1.4796
7	T	A	0.7688
8	F	A	2.1473
9	I	A	1.8524
10	G	A	0.7366
11	K	A	-0.2076
12	A	A	0.8073
13	I	A	1.4366
14	G	A	-0.0530
15	S	A	-0.4406
16	T	A	0.2565
17	A	A	-0.4586
18	R	A	-1.7785
19	S	A	-0.4224
20	W	A	0.2309
21	A	A	-1.1023
22	E	A	-1.9917
23	G	A	-0.6677
24	A	A	0.4686
25	M	A	1.8687
26	F	A	2.5952
27	A	A	1.7577
28	P	A	1.5322
29	A	A	0.7946
30	I	A	1.1175
31	G	A	-0.2730
32	P	A	-0.5135
33	A	A	-0.3266
34	K	A	-1.6793
35	E	A	-2.1991
36	I	A	0.1626
37	V	A	-0.1169
38	D	A	-2.6575
39	K	A	-2.3339
40	L	A	-0.4581
41	N	A	-1.8207
42	G	A	-1.8993
43	N	A	-1.9228