Project name: E682V

Chain sequence(s)	A: DAEFRHDSGYVVHHQKLVFFAEDVGSNKGAIIGLMVGGVVI
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)

• Minimal score value: -2.395
• Maximal score value: 2.6871
• Average score: 0.2829
• Total score value: 11.5993

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-2.0467
2	A	A	-1.2707
3	E	A	-1.7018
4	F	A	-0.2993
5	R	A	-1.5462
6	H	A	-1.4801
7	D	A	-0.9331
8	S	A	0.1156
9	G	A	1.2164
10	Y	A	2.2318
11	V	A	2.5959
12	V	A	1.5664
13	H	A	-0.1726
14	H	A	-1.3654
15	Q	A	-1.4373
16	K	A	-0.6198
17	L	A	1.9563
18	V	A	2.2729
19	F	A	2.6654
20	F	A	1.6710
21	A	A	-0.7285
22	E	A	-2.3950
23	D	A	-2.1305
24	V	A	-0.1008
25	G	A	-1.0722
26	S	A	-1.5455
27	N	A	-1.8110
28	K	A	-1.5499
29	G	A	0.6903
30	A	A	1.5805
31	I	A	2.3313
32	I	A	0.9567
33	G	A	-0.0408
34	L	A	0.6012
35	M	A	1.5781
36	V	A	1.8129
37	G	A	1.5404
38	G	A	1.2506
39	V	A	2.6871
40	V	A	2.6008
41	I	A	1.9249