Project name: 751e32ae79b1d1e

Chain sequence(s)	A: LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:53)

• Minimal score value: -1.9277
• Maximal score value: 1.6888
• Average score: -0.2493
• Total score value: -22.9334

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	L	A	0.4733
2	S	A	0.0173
3	C	A	0.3796
4	G	A	-0.5942
5	Q	A	-1.2825
6	V	A	0.0000
7	N	A	-1.0399
8	S	A	-0.3908
9	A	A	-0.0012
10	L	A	0.2039
11	A	A	0.0767
12	P	A	-0.0816
13	C	A	0.0000
14	I	A	0.8617
15	T	A	0.0861
16	F	A	0.0000
17	L	A	0.0000
18	T	A	-0.2938
19	K	A	-1.7181
20	G	A	-0.4799
21	G	A	-0.1637
22	V	A	1.6888
23	P	A	0.0000
24	S	A	-0.1977
25	G	A	-0.5320
26	P	A	-0.3586
27	C	A	0.0000
28	C	A	0.0000
29	S	A	-0.2439
30	G	A	-0.0906
31	V	A	0.0000
32	R	A	-1.8078
33	G	A	-0.7510
34	L	A	0.1715
35	L	A	0.5197
36	G	A	-0.3045
37	A	A	-0.0324
38	A	A	0.0000
39	K	A	-1.7085
40	T	A	-0.3579
41	T	A	0.0177
42	A	A	0.0009
43	D	A	-0.3445
44	R	A	-0.4293
45	Q	A	-0.3429
46	A	A	-0.0337
47	A	A	0.0000
48	C	A	0.0000
49	N	A	-1.2730
50	C	A	0.0000
51	L	A	0.1398
52	K	A	-0.5852
53	A	A	-0.0550
54	A	A	0.0298
55	A	A	-0.0695
56	G	A	-0.5024
57	S	A	-0.2411
58	L	A	0.0883
59	H	A	-1.0181
60	G	A	-0.6109
61	L	A	-0.0499
62	N	A	-1.0372
63	Q	A	-1.4362
64	G	A	-0.7131
65	N	A	-0.2509
66	A	A	-0.1381
67	A	A	0.0583
68	A	A	0.0347
69	L	A	0.0000
70	P	A	0.0000
71	G	A	-0.7969
72	R	A	-1.9277
73	C	A	0.0000
74	G	A	-0.4214
75	V	A	0.1256
76	S	A	-0.1110
77	I	A	0.2239
78	P	A	-0.1483
79	Y	A	-0.0651
80	K	A	-1.5726
81	I	A	0.0887
82	S	A	0.0011
83	T	A	-0.1069
84	S	A	-0.2243
85	T	A	-0.2755
86	N	A	-1.2742
87	C	A	0.0000
88	A	A	0.0459
89	T	A	-0.0605
90	I	A	0.0000
91	K	A	-1.3490
92	F	A	1.6283