Project name: 757d32a38ffb84

Chain sequence(s)	A: EVQLVESGGGVVQPGNSLRLSCAASGFSFSSGMSWVRQAPGKGLEWVSSISGNGKSTLYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGFGGSPGDPTPRGGYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:11)

• Minimal score value: -2.4682
• Maximal score value: 1.5749
• Average score: -0.6741
• Total score value: -82.9095

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.0190
2	V	A	-0.9259
3	Q	A	-1.2902
4	L	A	0.0000
5	V	A	0.1773
6	E	A	0.0000
7	S	A	-0.4170
8	G	A	-0.7427
9	G	A	0.0231
10	G	A	0.8106
11	V	A	1.5749
12	V	A	-0.0942
13	Q	A	-1.5246
14	P	A	-1.8195
15	G	A	-1.7709
16	N	A	-1.8032
17	S	A	-1.4706
18	L	A	-0.8747
19	R	A	-1.7756
20	L	A	0.0000
21	S	A	-0.4323
22	C	A	0.0000
23	A	A	-0.2341
24	A	A	0.0000
25	S	A	-0.9827
26	G	A	-1.1556
27	F	A	-0.3840
28	S	A	-0.2814
29	F	A	0.0000
30	S	A	-0.8121
31	S	A	-0.3473
32	G	A	-0.3975
33	M	A	0.0000
34	S	A	0.0000
35	W	A	0.0000
36	V	A	0.0000
37	R	A	0.0000
38	Q	A	-0.7821
39	A	A	-1.1483
40	P	A	-0.9542
41	G	A	-1.5041
42	K	A	-2.2443
43	G	A	-1.3788
44	L	A	-0.6421
45	E	A	-1.0942
46	W	A	0.0000
47	V	A	0.0000
48	S	A	0.0000
49	S	A	0.0000
50	I	A	0.0000
51	S	A	-0.7850
52	G	A	-1.2564
53	N	A	-2.2778
54	G	A	-2.0814
55	K	A	-2.3348
56	S	A	-1.0795
57	T	A	-0.0647
58	L	A	0.2887
59	Y	A	-0.6483
60	A	A	0.0000
61	D	A	-2.4135
62	S	A	-1.7616
63	V	A	0.0000
64	K	A	-2.4266
65	G	A	-1.6385
66	R	A	0.0000
67	F	A	0.0000
68	T	A	-0.6763
69	I	A	0.0000
70	S	A	-0.7302
71	R	A	-1.4594
72	D	A	-1.9297
73	N	A	-2.1102
74	A	A	-1.4461
75	K	A	-2.2413
76	T	A	-1.4534
77	T	A	0.0000
78	L	A	0.0000
79	Y	A	-0.5700
80	L	A	0.0000
81	Q	A	-1.0639
82	M	A	0.0000
83	N	A	-1.4281
84	S	A	-1.3630
85	L	A	0.0000
86	R	A	-2.4682
87	P	A	-2.0069
88	E	A	-2.3598
89	D	A	0.0000
90	T	A	-0.5814
91	A	A	0.0000
92	L	A	0.4412
93	Y	A	0.0000
94	Y	A	0.0000
95	C	A	0.0000
96	T	A	0.0000
97	I	A	0.0000
98	G	A	0.0000
99	F	A	0.3285
100	G	A	0.0000
101	G	A	-0.7484
102	S	A	-0.6804
103	P	A	-1.2523
104	G	A	-1.3642
105	D	A	-1.7569
106	P	A	-1.1892
107	T	A	-0.8270
108	P	A	0.0000
109	R	A	-2.0661
110	G	A	-1.1480
111	G	A	-0.6820
112	Y	A	0.4295
113	W	A	0.3975
114	G	A	-0.1697
115	Q	A	-0.9810
116	G	A	-0.2270
117	T	A	0.1164
118	L	A	0.8367
119	V	A	0.0000
120	T	A	0.2303
121	V	A	0.0000
122	S	A	-0.8145
123	S	A	-0.6983