Project name: query_structure

Status: done

Started: 2026-03-16 21:24:22
Settings
Chain sequence(s) A: CSGPGIVGNVLVDPSARIGKNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVCWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPGIIM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)
Show buried residues

Minimal score value
-3.5278
Maximal score value
2.2147
Average score
-0.729
Total score value
-84.568

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A 0.7494
2 S A 0.1498
3 G A 0.0793
4 P A -0.4661
5 G A -0.3507
6 I A 0.7161
7 V A 0.9231
8 G A -0.3802
9 N A -1.2519
10 V A -0.0034
11 L A 1.2433
12 V A 0.6997
13 D A -0.5453
14 P A -0.5567
15 S A -1.0634
16 A A -1.4217
17 R A -1.5969
18 I A -0.6893
19 G A -1.6026
20 K A -2.5596
21 N A -2.4529
22 C A 0.0000
23 S A -0.3535
24 I A 0.0000
25 G A 0.0000
26 P A -1.4111
27 N A -2.2165
28 V A 0.0000
29 S A -0.1191
30 L A 0.0000
31 G A -0.7100
32 P A -1.4216
33 G A -2.0237
34 V A 0.0000
35 V A -1.3838
36 V A 0.0000
37 E A -1.6212
38 D A -1.9243
39 G A -1.5731
40 V A 0.0000
41 C A -0.6651
42 I A 0.0000
43 R A -1.9340
44 R A -2.7242
45 C A 0.0000
46 T A -0.2105
47 V A 0.0000
48 L A -1.2144
49 R A -2.8247
50 D A -3.2992
51 A A 0.0000
52 R A -2.6455
53 I A 0.0000
54 R A -1.2702
55 S A -1.3361
56 H A -1.4340
57 S A 0.0000
58 W A -0.5320
59 L A 0.0000
60 E A -1.5003
61 S A -1.0111
62 C A 0.0000
63 I A 1.0472
64 V A 0.0000
65 C A -0.7907
66 W A -1.8769
67 R A -3.5278
68 C A 0.0000
69 R A -2.4214
70 V A 0.0000
71 G A 0.0000
72 Q A -1.5349
73 W A -0.8445
74 V A 0.0000
75 R A -1.6507
76 M A 0.0000
77 E A -1.1202
78 N A -0.9947
79 V A 0.9281
80 T A 0.0000
81 V A 1.2304
82 L A 0.0000
83 G A 0.0000
84 E A -1.8190
85 D A -2.5105
86 V A 0.0000
87 I A -1.4006
88 V A 0.0000
89 N A -2.4845
90 D A -2.3621
91 E A -2.7450
92 L A 0.0000
93 Y A -1.4523
94 L A 0.0000
95 N A -1.2857
96 G A -0.3611
97 A A 0.0000
98 S A 1.4685
99 V A 0.0000
100 L A 0.5329
101 P A -0.8770
102 H A -1.7767
103 K A -0.9746
104 S A -1.1886
105 I A 0.0000
106 G A -2.0931
107 E A -2.6060
108 S A -1.9249
109 V A -0.9189
110 P A -1.4319
111 E A -2.0304
112 P A -0.9341
113 G A 0.3123
114 I A 2.2147
115 I A 1.7268
116 M A 1.6491
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018