Project name: query_structure

Status: done

Started: 2026-03-16 23:31:45
Settings
Chain sequence(s) A: GSIPCGESCVWIPCISSVVGCACKNKVCYKN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:24)
Show buried residues

Minimal score value
-2.0417
Maximal score value
2.9594
Average score
0.4296
Total score value
13.3184

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -1.0825
2 S A 0.0159
3 I A 1.1597
4 P A 0.3052
5 C A 0.4614
6 G A -0.3078
7 E A 0.1694
8 S A 0.2648
9 C A 0.8935
10 V A 1.1609
11 W A 2.2227
12 I A 2.7857
13 P A 1.6382
14 C A 0.0000
15 I A 2.8569
16 S A 1.9276
17 S A 1.7969
18 V A 2.9594
19 V A 2.6485
20 G A 0.8730
21 C A 0.0000
22 A A -0.1228
23 C A -0.3873
24 K A -1.5358
25 N A -2.0417
26 K A -1.5473
27 V A -0.8960
28 C A 0.0000
29 Y A -0.5267
30 K A -0.7737
31 N A -1.5997
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018