Project name: 767345ce01cec54

Chain sequence(s)	A: MIIEYDGEIDFTKGRVVLWFSIPGSPPSRL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:11)

• Minimal score value: -2.4428
• Maximal score value: 3.6311
• Average score: 0.2388
• Total score value: 7.1626

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	2.5103
2	I	A	3.6311
3	I	A	2.7211
4	E	A	-0.0495
5	Y	A	0.1671
6	D	A	-2.0104
7	G	A	-2.1357
8	E	A	-2.4428
9	I	A	-1.2443
10	D	A	-1.7467
11	F	A	-0.4766
12	T	A	-1.1673
13	K	A	-2.2752
14	G	A	-1.7961
15	R	A	-1.4396
16	V	A	0.9170
17	V	A	3.1028
18	L	A	3.6048
19	W	A	3.3848
20	F	A	3.3219
21	S	A	1.6419
22	I	A	1.7978
23	P	A	0.1026
24	G	A	-0.5746
25	S	A	-0.2887
26	P	A	-0.6260
27	P	A	-0.6184
28	S	A	-0.1055
29	R	A	-1.2296
30	L	A	0.4864