Project name: 76c23254a9cb825

Status: done

Started: 2026-03-18 16:09:07
Settings
Chain sequence(s) A: SLKDELEEIYQTFKIIYDFFKEDIESGKMKGEDVIMLIKSNLDYGYGETKAYPIVKPLFEKIIKEGKKEGKDTVTIIEEFIEKLEELVKET
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:13)
Show buried residues

Minimal score value
-5.0402
Maximal score value
1.4074
Average score
-1.6798
Total score value
-152.8616

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -1.4218
2 L A -1.5332
3 K A -2.9683
4 D A -3.3187
5 E A -2.9555
6 L A 0.0000
7 E A -3.9956
8 E A -3.5441
9 I A 0.0000
10 Y A -2.3440
11 Q A -1.7968
12 T A -0.7294
13 F A 0.0000
14 K A -0.8541
15 I A 1.4074
16 I A 0.9755
17 Y A 0.0000
18 D A -0.8999
19 F A 1.1135
20 F A -0.6297
21 K A -1.9144
22 E A -3.3346
23 D A -3.2337
24 I A -3.3137
25 E A -3.6931
26 S A -2.8451
27 G A -2.7619
28 K A -3.0958
29 M A -2.9716
30 K A -3.5070
31 G A 0.0000
32 E A -2.9347
33 D A -2.7473
34 V A 0.0000
35 I A 0.0000
36 M A -0.4465
37 L A -0.2831
38 I A 0.0000
39 K A -0.7254
40 S A -0.1084
41 N A -0.3596
42 L A 0.0000
43 D A -0.4364
44 Y A 0.3747
45 G A -0.4182
46 Y A -0.9904
47 G A -1.0863
48 E A -2.1255
49 T A -1.7424
50 K A -2.0635
51 A A 0.0000
52 Y A -0.7679
53 P A -0.4943
54 I A 0.3866
55 V A 0.0000
56 K A -0.5848
57 P A -0.5790
58 L A -0.7223
59 F A 0.0000
60 E A -2.1811
61 K A -2.9909
62 I A -2.4882
63 I A -2.8729
64 K A -4.4323
65 E A -4.8797
66 G A 0.0000
67 K A -5.0402
68 K A -4.7472
69 E A -4.6002
70 G A -3.7722
71 K A -3.4849
72 D A -3.0916
73 T A -2.6351
74 V A 0.0000
75 T A -1.5078
76 I A 0.0000
77 I A 0.0000
78 E A -2.5598
79 E A -2.4508
80 F A 0.0000
81 I A 0.0000
82 E A -3.6491
83 K A -3.0657
84 L A 0.0000
85 E A -3.7367
86 E A -3.8140
87 L A -2.7350
88 V A 0.0000
89 K A -3.7119
90 E A -3.2227
91 T A -2.1713
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018