Project name: query_structure

Status: done

Started: 2026-03-17 01:31:17
Settings
Chain sequence(s) A: PWCQPGYAYNPVLGICTITLSRIEHPGNYDY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:10)
Show buried residues

Minimal score value
-2.016
Maximal score value
2.9878
Average score
0.6951
Total score value
21.5468

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P A 0.9422
2 W A 1.5748
3 C A 1.2024
4 Q A -0.1090
5 P A -0.4831
6 G A 0.3442
7 Y A 1.3678
8 A A 1.6677
9 Y A 2.5368
10 N A 2.1207
11 P A 1.5480
12 V A 2.6773
13 L A 2.7832
14 G A 1.8039
15 I A 2.9878
16 C A 2.3871
17 T A 1.8846
18 I A 1.9088
19 T A 1.5340
20 L A 1.5128
21 S A -0.1463
22 R A -0.7193
23 I A 0.6964
24 E A -1.5601
25 H A -2.0067
26 P A -1.7745
27 G A -1.7439
28 N A -2.0160
29 Y A -0.6697
30 D A -1.2686
31 Y A 0.5635
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018