Project name: query_structure

Status: done

Started: 2026-03-17 00:44:19
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVNAVTMWWYRQAPGKEREWVAAIKSQGAGTWYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCHVYVGAYRYEGRGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:31)
Show buried residues

Minimal score value
-3.593
Maximal score value
1.054
Average score
-0.8161
Total score value
-93.8551

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.5031
2 V A -1.2053
3 Q A -1.3999
4 L A 0.0000
5 V A 0.1467
6 E A 0.0000
7 S A -0.7750
8 G A -1.2031
9 G A -0.8416
10 G A -0.0707
11 L A 1.0540
12 V A 0.0231
13 Q A -1.2081
14 A A -1.3752
15 G A -1.3051
16 G A -0.8685
17 S A -1.2002
18 L A -0.9220
19 R A -2.1390
20 L A 0.0000
21 S A -0.5856
22 C A 0.0000
23 A A -0.4138
24 A A 0.0000
25 S A -0.8157
26 G A -1.0083
27 F A -0.3949
28 P A -0.8020
29 V A 0.0000
30 N A -1.6248
31 A A -0.6206
32 V A -0.1353
33 T A -0.3535
34 M A 0.0000
35 W A 0.4851
36 W A 0.0000
37 Y A -0.0243
38 R A 0.0000
39 Q A -2.0299
40 A A -2.0738
41 P A -1.4671
42 G A -1.9907
43 K A -3.3722
44 E A -3.5930
45 R A -2.7721
46 E A -1.6568
47 W A -0.4114
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 K A -1.5571
53 S A -1.4781
54 Q A -2.0190
55 G A -1.5516
56 A A -0.9429
57 G A -0.6093
58 T A -0.0322
59 W A 0.2139
60 Y A -0.4691
61 A A 0.0000
62 D A -2.3402
63 S A -1.7902
64 V A 0.0000
65 K A -2.5331
66 G A -1.8073
67 R A -1.5253
68 F A 0.0000
69 T A -0.7844
70 I A 0.0000
71 S A -1.0504
72 R A -2.5107
73 D A -2.4421
74 N A -2.7789
75 A A -1.8956
76 K A -2.6060
77 N A -2.1179
78 T A 0.0000
79 V A 0.0000
80 Y A -0.9575
81 L A 0.0000
82 Q A -1.2421
83 M A 0.0000
84 N A -1.4579
85 S A -1.2117
86 L A 0.0000
87 K A -2.1951
88 P A -1.8538
89 E A -2.3025
90 D A 0.0000
91 T A -0.9538
92 A A 0.0000
93 V A -0.7300
94 Y A 0.0000
95 Y A -0.5508
96 C A 0.0000
97 H A 0.0000
98 V A 0.0000
99 Y A 0.8147
100 V A 0.8187
101 G A 0.1904
102 A A 0.4495
103 Y A 0.8160
104 R A -0.8133
105 Y A -0.5556
106 E A -1.4766
107 G A -1.2165
108 R A -2.0494
109 G A 0.0000
110 T A 0.0000
111 Q A -1.2701
112 V A 0.0000
113 T A -0.3087
114 V A 0.0000
115 S A -0.7178
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018