Project name: 776f169bc26f944

Status: done

Started: 2026-06-22 16:06:48
Settings
Chain sequence(s) B: LMDEIMKLTKEIKELMKKAYELLKEDPEAAEKELKKVKEQAKKLKALLDA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:49)
Show buried residues

Minimal score value
-4.4414
Maximal score value
1.3742
Average score
-2.1392
Total score value
-106.9606

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L B 1.3742
2 M B 0.9032
3 D B -1.4351
4 E B -1.6403
5 I B -0.4027
6 M B -0.6626
7 K B -2.6420
8 L B -2.3163
9 T B -2.0919
10 K B -3.3446
11 E B -3.3736
12 I B -3.0183
13 K B -3.7716
14 E B -3.6579
15 L B 0.0000
16 M B -2.1464
17 K B -2.7729
18 K B -2.2277
19 A B 0.0000
20 Y B -1.0308
21 E B -2.5554
22 L B -2.5322
23 L B -1.7425
24 K B -2.6274
25 E B -3.2682
26 D B -3.0373
27 P B -2.6784
28 E B -3.3058
29 A B -3.0193
30 A B 0.0000
31 E B -3.6513
32 K B -3.7734
33 E B 0.0000
34 L B -2.9063
35 K B -4.2001
36 K B -3.8445
37 V B 0.0000
38 K B -3.9962
39 E B -4.4414
40 Q B -3.2650
41 A B -3.1708
42 K B -3.7893
43 K B -3.0645
44 L B -2.0090
45 K B -2.5551
46 A B -1.5879
47 L B -0.2411
48 L B 0.3022
49 D B -1.4587
50 A B -0.2844
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018