Project name: RP17-TPA

Status: done

Started: 2026-04-16 08:15:12
Settings
Chain sequence(s) A: MDAMKRGLCCVLLLCGAVFVSPSQEIHARRLARRGGVKRISALIYEETRGVLKVSDFPNWHTAYYFKQYFHFRDDLEVQWLDRWMLARKQFDLLSFFFAVLHAVDVFLKDLEPPIVVRFVRLIPVTDHSNAVMLSENRSLFFLRDIVEFRCHPGMTEYKLVVVGADGVGKSALTIQLIYPYDVPDYA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:19)
Show buried residues

Minimal score value
-2.9058
Maximal score value
4.4804
Average score
0.4131
Total score value
77.2528

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.0616
2 D A -1.9641
3 A A -1.1271
4 M A -0.4123
5 K A -1.9646
6 R A -1.8457
7 G A -0.0835
8 L A 1.5729
9 C A 2.1271
10 C A 2.8665
11 V A 4.1777
12 L A 4.3958
13 L A 4.4463
14 L A 4.4804
15 C A 3.6514
16 G A 3.0175
17 A A 3.0463
18 V A 3.7654
19 F A 3.7491
20 V A 2.9451
21 S A 1.2539
22 P A -0.2310
23 S A -1.0505
24 Q A -1.8143
25 E A -1.7729
26 I A 0.0466
27 H A -1.3830
28 A A -1.3444
29 R A -2.3166
30 R A -2.2857
31 L A -0.4218
32 A A -1.2034
33 R A -2.7145
34 R A -2.9058
35 G A -1.8083
36 G A -0.9353
37 V A 0.3553
38 K A -1.3856
39 R A -1.3220
40 I A 0.9984
41 S A 0.6046
42 A A 1.8150
43 L A 2.9768
44 I A 2.6343
45 Y A 1.3542
46 E A -1.5130
47 E A -2.6607
48 T A -2.1194
49 R A -2.2757
50 G A -0.7729
51 V A 1.1826
52 L A 0.4021
53 K A -0.9306
54 V A 0.1324
55 S A -0.9833
56 D A -1.8269
57 F A -0.6473
58 P A -0.8549
59 N A -0.8207
60 W A 0.7117
61 H A 0.0793
62 T A 0.4456
63 A A 0.0000
64 Y A 1.6800
65 Y A 1.9766
66 F A 1.9625
67 K A 0.9689
68 Q A 0.7086
69 Y A 1.6671
70 F A 1.0303
71 H A -0.6160
72 F A 0.2507
73 R A -1.3955
74 D A -2.2087
75 D A -1.7759
76 L A -0.7861
77 E A -1.2967
78 V A -0.2904
79 Q A -1.0273
80 W A 0.2568
81 L A 0.3495
82 D A -1.1650
83 R A -1.3621
84 W A -0.1408
85 M A -0.2161
86 L A -0.0569
87 A A -0.6433
88 R A -1.6705
89 K A -1.7865
90 Q A -0.3248
91 F A 0.9617
92 D A -0.3902
93 L A 1.9021
94 L A 2.4353
95 S A 2.4199
96 F A 3.8482
97 F A 4.1602
98 F A 4.0212
99 A A 2.7674
100 V A 2.8510
101 L A 2.5861
102 H A 1.2494
103 A A 1.5637
104 V A 1.7446
105 D A -0.2713
106 V A 0.4436
107 F A 2.1046
108 L A 1.3772
109 K A -1.3142
110 D A -1.7714
111 L A -1.2328
112 E A -2.0315
113 P A -0.6307
114 P A 0.6991
115 I A 2.4522
116 V A 2.5106
117 V A 3.3426
118 R A 1.1278
119 F A 2.4402
120 V A 2.2977
121 R A 0.2488
122 L A 1.7559
123 I A 0.7210
124 P A 0.3555
125 V A 1.1082
126 T A -0.4611
127 D A -2.0033
128 H A -1.9460
129 S A -1.2813
130 N A -1.2765
131 A A 0.5013
132 V A 2.3372
133 M A 2.2620
134 L A 1.9214
135 S A -0.1040
136 E A -2.5031
137 N A -2.6823
138 R A -2.3519
139 S A -0.5117
140 L A 1.7419
141 F A 2.5589
142 F A 1.9141
143 L A 1.7422
144 R A -0.4923
145 D A 0.1641
146 I A 1.7222
147 V A 1.0932
148 E A -0.4266
149 F A 0.9496
150 R A -1.1129
151 C A -0.4181
152 H A -0.9447
153 P A -0.7772
154 G A -0.4072
155 M A 0.4074
156 T A 0.7101
157 E A 0.0385
158 Y A 0.9181
159 K A -0.0942
160 L A 1.1951
161 V A 1.9632
162 V A 2.4019
163 V A 2.0092
164 G A 0.2877
165 A A -0.0237
166 D A -1.9340
167 G A 0.1021
168 V A 1.5112
169 G A -0.4257
170 K A -1.7543
171 S A -0.5079
172 A A 1.3030
173 L A 1.9391
174 T A 1.4613
175 I A 1.7901
176 Q A 1.0009
177 L A 1.9873
178 I A 2.8825
179 Y A 2.7362
180 P A 1.5226
181 Y A 1.3874
182 D A -0.5321
183 V A 0.8024
184 P A -0.2600
185 D A -1.0273
186 Y A 0.6766
187 A A 0.1532
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018