Project name: gpgpgp

Status: done

Started: 2026-05-20 19:36:40
Settings
Chain sequence(s) A: HMGPGPGYKAADMWGPPNDPAGPGPGPGIKADSLDIGPGPGELGGTNVPAEGPGPGRQWVSAGRRVGPGPGPENAKEKPGPGPGRQWVSAGRRVGPGPGPGIKADSLDIGPGPGPENAKEKPGPGPGPGIKADSLDIGPGPGRQWVSAGRRVGPGPGYKAADMWGPPNDPAGPGPGRQWVSAGRRVGPGPGELGGTNVPAEGPGPGYKAADMWGPPNDPAGPGPGRQWVSAGRRVGPGPGYKAADMWGPPNDPAGPGPGPENAKEKPGPGPGYKAADMWGPPNDPAGPGPGPGIKADSLDIGPGPGYKAADMWGPPNDPAGPGPGYKAADMWGPPNDPAGPGPGYKAADMWGPPNDPAGPGPGELGGTNVPAEGPGPGPENAKEKPGPGPGELGGTNVPAEGPGPGRQWVSAGRRV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:09)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:09)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:09)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:09)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:01)
Show buried residues

Minimal score value
-3.9275
Maximal score value
1.9296
Average score
-0.9421
Total score value
-391.903

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 H A -0.5778
2 M A 0.2200
3 G A -0.3936
4 P A -0.6117
5 G A -0.8140
6 P A -0.7748
7 G A -0.4757
8 Y A 0.2114
9 K A -1.3854
10 A A -0.7377
11 A A -0.7255
12 D A -1.1229
13 M A 0.6330
14 W A 0.8306
15 G A -0.1618
16 P A -0.6765
17 P A -1.4877
18 N A -2.5716
19 D A -2.7637
20 P A -1.5493
21 A A -0.7525
22 G A -0.9298
23 P A -0.8230
24 G A -0.9843
25 P A -0.9210
26 G A -0.7099
27 P A -0.6097
28 G A -0.2423
29 I A 0.7738
30 K A -1.1994
31 A A -1.1121
32 D A -2.1100
33 S A -0.7066
34 L A 0.6813
35 D A -0.4684
36 I A 1.1867
37 G A -0.0254
38 P A -0.6004
39 G A -0.9851
40 P A -1.2272
41 G A -1.3143
42 E A -1.5216
43 L A 0.0357
44 G A -0.5407
45 G A -0.5870
46 T A -0.3879
47 N A -0.6444
48 V A 0.6873
49 P A -0.1587
50 A A -0.7847
51 E A -1.9459
52 G A -1.6256
53 P A -1.1629
54 G A -1.1391
55 P A -1.3665
56 G A -1.7692
57 R A -2.2074
58 Q A -1.2167
59 W A 0.8931
60 V A 1.6837
61 S A 0.5252
62 A A -0.3445
63 G A -1.4652
64 R A -2.6091
65 R A -2.1263
66 V A 0.0520
67 G A -0.6004
68 P A -0.6592
69 G A -0.7639
70 P A -1.1015
71 G A -1.5537
72 P A -1.8274
73 E A -2.7291
74 N A -2.6082
75 A A -2.2478
76 K A -3.2128
77 E A -3.5972
78 K A -3.2429
79 P A -2.0132
80 G A -1.4969
81 P A -1.0736
82 G A -1.1896
83 P A -1.2673
84 G A -1.9620
85 R A -2.4963
86 Q A -1.2257
87 W A 1.0070
88 V A 1.9296
89 S A 0.4338
90 A A -0.0816
91 G A -1.6119
92 R A -2.6426
93 R A -2.0870
94 V A 0.1328
95 G A -0.2512
96 P A -0.4125
97 G A -0.9868
98 P A -0.9663
99 G A -0.9531
100 P A -0.4357
101 G A -0.0588
102 I A 0.9123
103 K A -1.2595
104 A A -1.2903
105 D A -1.9580
106 S A -0.8503
107 L A 0.6543
108 D A -0.2281
109 I A 1.2090
110 G A -0.2504
111 P A -0.5769
112 G A -0.9927
113 P A -1.1327
114 G A -1.4056
115 P A -1.8538
116 E A -2.9107
117 N A -2.9884
118 A A -2.2932
119 K A -3.6083
120 E A -3.9275
121 K A -3.2958
122 P A -2.0152
123 G A -1.3827
124 P A -0.9011
125 G A -0.9887
126 P A -0.8987
127 G A -0.9554
128 P A -0.5382
129 G A -0.1223
130 I A 0.7336
131 K A -1.3636
132 A A -1.2614
133 D A -2.0708
134 S A -0.8614
135 L A 0.6780
136 D A -0.5451
137 I A 1.2000
138 G A -0.0499
139 P A -0.7067
140 G A -1.0560
141 P A -1.4905
142 G A -1.7853
143 R A -2.2587
144 Q A -1.2635
145 W A 0.8354
146 V A 1.3887
147 S A 0.1868
148 A A -0.6573
149 G A -1.5013
150 R A -2.5579
151 R A -2.2665
152 V A -0.4708
153 G A -0.6632
154 P A -0.7524
155 G A -0.6845
156 P A -0.5630
157 G A -0.4393
158 Y A 0.1277
159 K A -1.0822
160 A A -0.7231
161 A A -0.6583
162 D A -0.9125
163 M A 0.4936
164 W A 0.9276
165 G A -0.0204
166 P A -0.7264
167 P A -1.5028
168 N A -2.4801
169 D A -2.6806
170 P A -1.5415
171 A A -0.8003
172 G A -0.7568
173 P A -0.7528
174 G A -1.1572
175 P A -1.2497
176 G A -1.8278
177 R A -2.3916
178 Q A -1.2798
179 W A 0.9698
180 V A 1.7400
181 S A 0.6405
182 A A -0.2444
183 G A -1.6075
184 R A -2.6008
185 R A -2.0345
186 V A 0.0763
187 G A -0.4163
188 P A -0.4146
189 G A -1.1207
190 P A -1.1932
191 G A -1.3557
192 E A -1.5159
193 L A 0.2031
194 G A -0.2651
195 G A -0.6501
196 T A -0.6196
197 N A -0.5730
198 V A 1.0089
199 P A -0.0695
200 A A -0.7615
201 E A -2.1279
202 G A -1.6141
203 P A -1.1805
204 G A -0.9375
205 P A -0.5907
206 G A -0.4149
207 Y A 0.2080
208 K A -1.1106
209 A A -0.9107
210 A A -0.9631
211 D A -0.9765
212 M A 0.6055
213 W A 0.9865
214 G A -0.2115
215 P A -0.8723
216 P A -1.3646
217 N A -2.5570
218 D A -2.7672
219 P A -1.6431
220 A A -1.0206
221 G A -0.9952
222 P A -0.8046
223 G A -1.1454
224 P A -1.3717
225 G A -1.7841
226 R A -2.5030
227 Q A -1.2354
228 W A 0.9419
229 V A 1.8999
230 S A 0.5573
231 A A -0.5956
232 G A -1.5330
233 R A -2.5731
234 R A -2.1693
235 V A -0.0963
236 G A -0.7280
237 P A -0.6507
238 G A -0.7598
239 P A -0.5237
240 G A -0.4050
241 Y A 0.3264
242 K A -1.1691
243 A A -0.6434
244 A A -0.7935
245 D A -1.1233
246 M A 0.5639
247 W A 0.7494
248 G A -0.1879
249 P A -0.7073
250 P A -1.4642
251 N A -2.4760
252 D A -2.7046
253 P A -1.7199
254 A A -0.9850
255 G A -1.0053
256 P A -0.8251
257 G A -0.9700
258 P A -0.8936
259 G A -1.2091
260 P A -1.7303
261 E A -2.8422
262 N A -2.8554
263 A A -2.4201
264 K A -3.5630
265 E A -3.7334
266 K A -3.2820
267 P A -2.1450
268 G A -1.4414
269 P A -0.9941
270 G A -0.9252
271 P A -0.5398
272 G A -0.3994
273 Y A 0.1172
274 K A -1.2173
275 A A -0.7576
276 A A -0.6964
277 D A -1.1699
278 M A 0.6607
279 W A 0.9595
280 G A -0.2807
281 P A -0.7456
282 P A -1.5743
283 N A -2.4356
284 D A -2.6886
285 P A -1.5682
286 A A -1.1103
287 G A -1.0737
288 P A -0.8233
289 G A -0.9615
290 P A -0.9697
291 G A -0.7375
292 P A -0.4063
293 G A -0.1080
294 I A 0.5837
295 K A -1.1911
296 A A -1.0428
297 D A -1.9405
298 S A -0.9271
299 L A 0.6003
300 D A -0.3667
301 I A 1.1521
302 G A -0.0934
303 P A -0.5515
304 G A -0.6286
305 P A -0.5879
306 G A -0.4028
307 Y A 0.1469
308 K A -1.2805
309 A A -0.9609
310 A A -0.8074
311 D A -1.1775
312 M A 0.6532
313 W A 0.9282
314 G A -0.1957
315 P A -0.6689
316 P A -1.4431
317 N A -2.4806
318 D A -2.6366
319 P A -1.5538
320 A A -0.7876
321 G A -0.7749
322 P A -0.7905
323 G A -0.7943
324 P A -0.5446
325 G A -0.4194
326 Y A 0.1734
327 K A -1.3141
328 A A -0.7419
329 A A -0.7166
330 D A -1.1262
331 M A 0.6150
332 W A 0.8687
333 G A -0.1471
334 P A -0.4059
335 P A -1.3225
336 N A -2.4732
337 D A -2.6758
338 P A -1.6468
339 A A -0.8102
340 G A -0.9809
341 P A -0.7987
342 G A -0.9348
343 P A -0.7897
344 G A -0.5282
345 Y A 0.2091
346 K A -1.4034
347 A A -0.8420
348 A A -0.7252
349 D A -1.1622
350 M A 0.6707
351 W A 0.9297
352 G A -0.0541
353 P A -0.8611
354 P A -1.5510
355 N A -2.3928
356 D A -2.6793
357 P A -1.6134
358 A A -0.8139
359 G A -0.9860
360 P A -0.8533
361 G A -1.1506
362 P A -1.0241
363 G A -1.3589
364 E A -1.5072
365 L A 0.1074
366 G A -0.4562
367 G A -0.6967
368 T A -0.6949
369 N A -0.5891
370 V A 0.7425
371 P A 0.0167
372 A A -0.9030
373 E A -1.9367
374 G A -1.6227
375 P A -1.2096
376 G A -0.9860
377 P A -1.1221
378 G A -1.4517
379 P A -1.7969
380 E A -2.9105
381 N A -2.9799
382 A A -2.4916
383 K A -3.6581
384 E A -3.8130
385 K A -3.3164
386 P A -1.9711
387 G A -1.4559
388 P A -1.0725
389 G A -0.9738
390 P A -1.2007
391 G A -1.4005
392 E A -1.5137
393 L A 0.1342
394 G A -0.6802
395 G A -0.6807
396 T A -0.4894
397 N A -0.6496
398 V A 0.7617
399 P A 0.0329
400 A A -0.7340
401 E A -1.9371
402 G A -1.6090
403 P A -1.1243
404 G A -1.1537
405 P A -1.3822
406 G A -1.8155
407 R A -2.2482
408 Q A -1.2936
409 W A 0.8836
410 V A 1.7126
411 S A 0.5517
412 A A -0.1614
413 G A -1.5440
414 R A -2.5144
415 R A -1.9729
416 V A 0.3976
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018