Project name: query_structure

Status: done

Started: 2026-03-16 23:52:41
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGSYSDYRISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVYRIGGYRHRYLVLGEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:08)
Show buried residues

Minimal score value
-3.2838
Maximal score value
2.0267
Average score
-0.663
Total score value
-68.2844

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.0372
2 Q A -1.4668
3 V A 0.0000
4 D A -1.3504
5 I A 0.0000
6 V A 1.0574
7 P A 0.1878
8 S A -0.6114
9 Q A -1.7515
10 G A 0.0000
11 E A -2.5879
12 I A 0.0000
13 S A -1.0291
14 V A -0.2009
15 G A -1.2695
16 E A -2.1466
17 S A -0.9113
18 K A -0.2656
19 F A 2.0267
20 F A 0.0000
21 L A 0.9391
22 C A 0.0000
23 Q A -1.3249
24 V A 0.0000
25 A A -0.5869
26 G A -0.3539
27 S A -0.0325
28 Y A 0.2112
29 S A -1.1152
30 D A -1.9501
31 Y A -0.7940
32 R A -1.1877
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.4677
37 S A -1.4341
38 P A -1.3466
39 N A -2.1104
40 G A -2.2831
41 E A -3.2838
42 K A -2.8852
43 L A 0.0000
44 T A -1.1153
45 P A -1.0119
46 N A -1.9549
47 Q A -2.0279
48 Q A -2.0820
49 R A -1.4689
50 I A 0.0000
51 S A -0.2625
52 V A 0.0000
53 V A 0.7194
54 W A -0.5917
55 N A -1.8552
56 D A -3.0194
57 D A -3.2407
58 S A -1.9450
59 S A -1.6039
60 S A 0.0000
61 T A 0.7341
62 L A 0.0000
63 T A 0.9226
64 I A 0.0000
65 Y A -0.5342
66 N A -1.8835
67 A A 0.0000
68 N A -1.0956
69 I A -0.0471
70 D A -1.5576
71 D A 0.0000
72 A A -0.7391
73 G A -0.3461
74 I A 0.2930
75 Y A 0.0000
76 K A -1.2628
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 Y A 0.4795
81 R A 0.1409
82 I A 0.1050
83 G A -0.4197
84 G A -0.7431
85 Y A -0.2469
86 R A -2.1607
87 H A -1.9323
88 R A -1.7147
89 Y A 0.5914
90 L A 1.5740
91 V A 1.8160
92 L A 1.0280
93 G A -0.4505
94 E A -1.8834
95 A A -1.5124
96 T A -0.7395
97 V A 0.0000
98 N A -1.2548
99 V A 0.0000
100 K A -1.8547
101 I A 0.0000
102 F A -0.3450
103 Q A -0.4976
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018