| Chain sequence(s) |
A: MDVQLQDSGGESVQAGGSLRLTCVGSGNSFIRYCMAWFRQAPGKGLEEIVESGQFEFQTWNPDSVKGRFTISRDNAPNTGSLHMNSLQSEDTAAYFCAAGMICPIFGRTQMSADMDYWGRGTQVTVSSHHHHHH
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:00)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:00)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:00)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:01:18)
[INFO] Auto_mut: Residue number 57 from chain A and a score of 1.645 (phenylalanine)
selected for automated muatation (00:01:18)
[INFO] Auto_mut: Residue number 55 from chain A and a score of 1.021 (phenylalanine)
selected for automated muatation (00:01:18)
[INFO] Auto_mut: Residue number 102 from chain A and a score of 0.877 (isoleucine) selected
for automated muatation (00:01:18)
[INFO] Auto_mut: Residue number 101 from chain A and a score of 0.854 (methionine) selected
for automated muatation (00:01:18)
[INFO] Auto_mut: Residue number 58 from chain A and a score of 0.564 (glutamine) selected
for automated muatation (00:01:18)
[INFO] Auto_mut: Residue number 54 from chain A and a score of 0.462 (glutamine) selected
for automated muatation (00:01:18)
[INFO] Auto_mut: Mutating residue number 57 from chain A (phenylalanine) into aspartic acid
Mutating residue number 57 from chain A (phenylalanine) into aspartic acid (00:01:18)
[INFO] Auto_mut: Mutating residue number 55 from chain A (phenylalanine) into glutamic acid
Mutating residue number 55 from chain A (phenylalanine) into glutamic acid (00:01:18)
[INFO] Auto_mut: Mutating residue number 57 from chain A (phenylalanine) into glutamic acid
Mutating residue number 57 from chain A (phenylalanine) into glutamic acid (00:01:18)
[INFO] Auto_mut: Mutating residue number 57 from chain A (phenylalanine) into arginine (00:01:56)
[INFO] Auto_mut: Mutating residue number 55 from chain A (phenylalanine) into lysine (00:02:03)
[INFO] Auto_mut: Mutating residue number 57 from chain A (phenylalanine) into lysine (00:02:09)
[INFO] Auto_mut: Mutating residue number 55 from chain A (phenylalanine) into aspartic acid
Mutating residue number 55 from chain A (phenylalanine) into aspartic acid (00:02:45)
[INFO] Auto_mut: Mutating residue number 102 from chain A (isoleucine) into glutamic acid (00:03:05)
[INFO] Auto_mut: Mutating residue number 102 from chain A (isoleucine) into aspartic acid (00:03:08)
[INFO] Auto_mut: Mutating residue number 55 from chain A (phenylalanine) into arginine (00:03:27)
[INFO] Auto_mut: Mutating residue number 102 from chain A (isoleucine) into lysine (00:03:48)
[INFO] Auto_mut: Mutating residue number 102 from chain A (isoleucine) into arginine (00:03:54)
[INFO] Auto_mut: Mutating residue number 101 from chain A (methionine) into glutamic acid (00:04:21)
[INFO] Auto_mut: Mutating residue number 101 from chain A (methionine) into aspartic acid (00:04:39)
[INFO] Auto_mut: Mutating residue number 58 from chain A (glutamine) into glutamic acid (00:04:46)
[INFO] Auto_mut: Mutating residue number 101 from chain A (methionine) into lysine (00:05:14)
[INFO] Auto_mut: Mutating residue number 101 from chain A (methionine) into arginine (00:05:24)
[INFO] Auto_mut: Mutating residue number 58 from chain A (glutamine) into lysine (00:05:33)
[INFO] Auto_mut: Mutating residue number 58 from chain A (glutamine) into aspartic acid (00:06:18)
[INFO] Auto_mut: Mutating residue number 54 from chain A (glutamine) into glutamic acid (00:06:22)
[INFO] Auto_mut: Mutating residue number 54 from chain A (glutamine) into aspartic acid (00:06:32)
[INFO] Auto_mut: Mutating residue number 58 from chain A (glutamine) into arginine (00:07:00)
[INFO] Auto_mut: Mutating residue number 54 from chain A (glutamine) into lysine (00:07:09)
[INFO] Auto_mut: Mutating residue number 54 from chain A (glutamine) into arginine (00:07:13)
[INFO] Auto_mut: Effect of mutation residue number 57 from chain A (phenylalanine) into
glutamic acid: Energy difference: -0.6678 kcal/mol, Difference in average
score from the base case: -0.0602 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 57 from chain A (phenylalanine) into
lysine: Energy difference: -0.5535 kcal/mol, Difference in average score
from the base case: -0.0601 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 57 from chain A (phenylalanine) into
aspartic acid: Energy difference: 0.0214 kcal/mol, Difference in average
score from the base case: -0.0617 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 57 from chain A (phenylalanine) into
arginine: Energy difference: -1.1369 kcal/mol, Difference in average score
from the base case: -0.0664 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 55 from chain A (phenylalanine) into
glutamic acid: Energy difference: 0.6117 kcal/mol, Difference in average
score from the base case: -0.0910 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 55 from chain A (phenylalanine) into
lysine: Energy difference: 0.7569 kcal/mol, Difference in average score
from the base case: -0.0838 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 55 from chain A (phenylalanine) into
aspartic acid: Energy difference: 0.5431 kcal/mol, Difference in average
score from the base case: -0.0812 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 55 from chain A (phenylalanine) into
arginine: Energy difference: 1.0129 kcal/mol, Difference in average score
from the base case: -0.0925 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 102 from chain A (isoleucine) into
glutamic acid: Energy difference: 0.7113 kcal/mol, Difference in average
score from the base case: -0.0365 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 102 from chain A (isoleucine) into
lysine: Energy difference: 0.0788 kcal/mol, Difference in average score
from the base case: -0.0477 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 102 from chain A (isoleucine) into
aspartic acid: Energy difference: 1.1820 kcal/mol, Difference in average
score from the base case: -0.0498 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 102 from chain A (isoleucine) into
arginine: Energy difference: -0.1522 kcal/mol, Difference in average score
from the base case: -0.0535 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 101 from chain A (methionine) into
glutamic acid: Energy difference: -0.2629 kcal/mol, Difference in average
score from the base case: -0.0476 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 101 from chain A (methionine) into
lysine: Energy difference: -0.0119 kcal/mol, Difference in average score
from the base case: -0.0625 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 101 from chain A (methionine) into
aspartic acid: Energy difference: 0.2484 kcal/mol, Difference in average
score from the base case: -0.0620 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 101 from chain A (methionine) into
arginine: Energy difference: -0.1936 kcal/mol, Difference in average score
from the base case: -0.0717 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 58 from chain A (glutamine) into glutamic
acid: Energy difference: 0.4245 kcal/mol, Difference in average score from
the base case: 0.0018 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 58 from chain A (glutamine) into lysine:
Energy difference: -0.6872 kcal/mol, Difference in average score from the
base case: 0.0018 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 58 from chain A (glutamine) into aspartic
acid: Energy difference: 0.5350 kcal/mol, Difference in average score from
the base case: 0.0075 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 58 from chain A (glutamine) into
arginine: Energy difference: -0.1573 kcal/mol, Difference in average score
from the base case: -0.0021 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 54 from chain A (glutamine) into glutamic
acid: Energy difference: -0.7452 kcal/mol, Difference in average score from
the base case: 0.0112 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 54 from chain A (glutamine) into lysine:
Energy difference: 0.1265 kcal/mol, Difference in average score from the
base case: -0.0088 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 54 from chain A (glutamine) into aspartic
acid: Energy difference: 0.4579 kcal/mol, Difference in average score from
the base case: 0.0115 (00:08:08)
[INFO] Auto_mut: Effect of mutation residue number 54 from chain A (glutamine) into
arginine: Energy difference: -0.5505 kcal/mol, Difference in average score
from the base case: 0.0099 (00:08:08)
[INFO] Main: Simulation completed successfully. (00:08:12)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | M | A | -0.1352 | |
| 2 | D | A | -1.5064 | |
| 3 | V | A | -1.3255 | |
| 4 | Q | A | -1.7315 | |
| 5 | L | A | 0.0000 | |
| 6 | Q | A | -1.7313 | |
| 7 | D | A | -1.3472 | |
| 8 | S | A | -1.4693 | |
| 9 | G | A | -1.5692 | |
| 10 | G | A | -1.9771 | |
| 11 | E | A | -2.4984 | |
| 12 | S | A | -1.5037 | |
| 13 | V | A | -1.2045 | |
| 14 | Q | A | -1.7955 | |
| 15 | A | A | -1.8065 | |
| 16 | G | A | -1.4292 | |
| 17 | G | A | -1.0787 | |
| 18 | S | A | -1.3227 | |
| 19 | L | A | -1.5006 | |
| 20 | R | A | -2.2849 | |
| 21 | L | A | 0.0000 | |
| 22 | T | A | -0.7179 | |
| 23 | C | A | 0.0000 | |
| 24 | V | A | -0.4121 | |
| 25 | G | A | 0.0000 | |
| 26 | S | A | -1.0251 | |
| 27 | G | A | -0.9749 | |
| 28 | N | A | -1.5290 | |
| 29 | S | A | -0.8774 | |
| 30 | F | A | 0.0000 | |
| 31 | I | A | -1.0445 | |
| 32 | R | A | -1.2158 | |
| 33 | Y | A | 0.0000 | |
| 34 | C | A | 0.0000 | |
| 35 | M | A | 0.0000 | |
| 36 | A | A | 0.0000 | |
| 37 | W | A | 0.0000 | |
| 38 | F | A | 0.0000 | |
| 39 | R | A | -0.8450 | |
| 40 | Q | A | -1.3314 | |
| 41 | A | A | -1.5697 | |
| 42 | P | A | -1.2741 | |
| 43 | G | A | -1.5110 | |
| 44 | K | A | -2.2655 | |
| 45 | G | A | -1.2949 | |
| 46 | L | A | -0.1880 | |
| 47 | E | A | -0.7171 | |
| 48 | E | A | -0.4703 | |
| 49 | I | A | 0.0000 | |
| 50 | V | A | 0.0000 | |
| 51 | E | A | 0.0000 | |
| 52 | S | A | 0.0000 | |
| 53 | G | A | 0.0000 | |
| 54 | Q | A | 0.4618 | |
| 55 | F | A | 1.0213 | |
| 56 | E | A | 0.0350 | |
| 57 | F | A | 1.6445 | |
| 58 | Q | A | 0.5644 | |
| 59 | T | A | -0.0024 | |
| 60 | W | A | -0.3391 | |
| 61 | N | A | -1.2910 | |
| 62 | P | A | -1.7192 | |
| 63 | D | A | -2.7055 | |
| 64 | S | A | -1.9429 | |
| 65 | V | A | 0.0000 | |
| 66 | K | A | -2.8350 | |
| 67 | G | A | -1.9534 | |
| 68 | R | A | -1.8332 | |
| 69 | F | A | 0.0000 | |
| 70 | T | A | -0.9653 | |
| 71 | I | A | 0.0000 | |
| 72 | S | A | -1.0108 | |
| 73 | R | A | -1.3869 | |
| 74 | D | A | -2.4112 | |
| 75 | N | A | -2.3489 | |
| 76 | A | A | -1.4227 | |
| 77 | P | A | -1.1337 | |
| 78 | N | A | -1.4946 | |
| 79 | T | A | -1.0464 | |
| 80 | G | A | 0.0000 | |
| 81 | S | A | 0.0000 | |
| 82 | L | A | 0.0000 | |
| 83 | H | A | -1.3153 | |
| 84 | M | A | 0.0000 | |
| 85 | N | A | -1.6532 | |
| 86 | S | A | -1.2794 | |
| 87 | L | A | 0.0000 | |
| 88 | Q | A | -1.9750 | |
| 89 | S | A | -1.7878 | |
| 90 | E | A | -2.1952 | |
| 91 | D | A | 0.0000 | |
| 92 | T | A | -1.1792 | |
| 93 | A | A | 0.0000 | |
| 94 | A | A | -0.8625 | |
| 95 | Y | A | 0.0000 | |
| 96 | F | A | -0.5543 | |
| 97 | C | A | 0.0000 | |
| 98 | A | A | 0.0000 | |
| 99 | A | A | 0.0000 | |
| 100 | G | A | 0.0000 | |
| 101 | M | A | 0.8540 | |
| 102 | I | A | 0.8775 | |
| 103 | C | A | 0.0000 | |
| 104 | P | A | 0.0000 | |
| 105 | I | A | -0.0676 | |
| 106 | F | A | -0.1737 | |
| 107 | G | A | -1.2408 | |
| 108 | R | A | -1.8793 | |
| 109 | T | A | -1.2993 | |
| 110 | Q | A | -1.5136 | |
| 111 | M | A | -0.6079 | |
| 112 | S | A | -0.4577 | |
| 113 | A | A | -0.5752 | |
| 114 | D | A | -0.7282 | |
| 115 | M | A | 0.0000 | |
| 116 | D | A | -1.3367 | |
| 117 | Y | A | -0.9503 | |
| 118 | W | A | -0.5779 | |
| 119 | G | A | -1.1753 | |
| 120 | R | A | -2.1221 | |
| 121 | G | A | 0.0000 | |
| 122 | T | A | -1.5930 | |
| 123 | Q | A | -1.8792 | |
| 124 | V | A | 0.0000 | |
| 125 | T | A | -1.3927 | |
| 126 | V | A | 0.0000 | |
| 127 | S | A | -1.5218 | |
| 128 | S | A | -1.8778 | |
| 129 | H | A | -2.3590 | |
| 130 | H | A | -2.4556 | |
| 131 | H | A | -2.6775 | |
| 132 | H | A | -2.6372 | |
| 133 | H | A | -2.3653 | |
| 134 | H | A | -1.8702 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| FR57A | -1.1369 | -0.0664 | View | CSV | PDB |
| FE57A | -0.6678 | -0.0602 | View | CSV | PDB |
| MR101A | -0.1936 | -0.0717 | View | CSV | PDB |
| ME101A | -0.2629 | -0.0476 | View | CSV | PDB |
| IR102A | -0.1522 | -0.0535 | View | CSV | PDB |
| QR58A | -0.1573 | -0.0021 | View | CSV | PDB |
| IK102A | 0.0788 | -0.0477 | View | CSV | PDB |
| FD55A | 0.5431 | -0.0812 | View | CSV | PDB |
| FE55A | 0.6117 | -0.091 | View | CSV | PDB |
| QK54A | 0.1265 | -0.0088 | View | CSV | PDB |
| QK58A | -0.6872 | 0.0018 | View | CSV | PDB |
| QE54A | -0.7452 | 0.0112 | View | CSV | PDB |