Project name: 78df879aecdda88

Status: done

Started: 2026-04-05 05:03:46
Settings
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSALETVLTQSPGTLSLSPGERATLSCRASQSLGSSYLAWYQQKPGQAPRLLIYGASSRAPGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYADSPITFGQGTRLEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:01)
Show buried residues

Minimal score value
-3.483
Maximal score value
1.7578
Average score
-0.5525
Total score value
-135.3722

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 Q A -1.5053
3 V A -0.9161
4 Q A -1.3087
5 L A 0.0000
6 V A 0.1339
7 Q A 0.0000
8 S A -0.3420
9 G A -0.9250
10 A A -0.3178
11 E A -0.5561
12 V A 0.6365
13 K A -1.2475
14 K A -2.1803
15 P A -1.8296
16 G A -1.4327
17 S A -1.2601
18 S A -1.3789
19 V A 0.0000
20 K A -2.0838
21 V A 0.0000
22 S A -0.5959
23 C A 0.0000
24 K A -1.0078
25 A A 0.0000
26 S A -0.9874
27 G A -1.0329
28 Y A -0.4120
29 T A -0.4108
30 F A 0.0000
31 S A -0.2201
32 S A -0.1253
33 N A 0.2525
34 V A 0.7177
35 I A 0.0000
36 S A 0.0000
37 W A 0.0000
38 V A 0.0000
39 R A 0.0000
40 Q A -0.4369
41 A A -0.5811
42 P A -0.8475
43 G A -1.2236
44 Q A -1.8849
45 G A -1.3254
46 L A 0.0000
47 E A -0.7952
48 W A 0.0000
49 M A 0.0000
50 G A 0.0000
51 G A 0.0000
52 V A 0.0000
53 I A 1.1685
54 P A 0.8100
55 I A 1.7578
56 V A 1.0755
57 D A 0.1572
58 I A 1.6354
59 A A 0.4942
60 N A -0.5900
61 Y A -1.1781
62 A A 0.0000
63 Q A -2.2791
64 R A -1.9080
65 F A 0.0000
66 K A -2.6354
67 G A -1.6653
68 R A -1.4549
69 V A 0.0000
70 T A -0.9745
71 I A 0.0000
72 T A -0.2226
73 A A -0.4359
74 D A -1.3780
75 E A -1.9345
76 S A -1.3506
77 T A -1.1635
78 S A -1.3497
79 T A 0.0000
80 T A 0.0000
81 Y A -0.6083
82 M A 0.0000
83 E A -1.5579
84 L A 0.0000
85 S A -1.0919
86 S A -1.0381
87 L A 0.0000
88 R A -1.9927
89 S A -1.5604
90 E A -1.1121
91 D A 0.0000
92 T A -0.0772
93 A A 0.0000
94 V A 0.8268
95 Y A 0.0000
96 Y A 0.0000
97 C A 0.0000
98 A A 0.0000
99 S A 0.0000
100 T A 0.0000
101 L A 0.6440
102 G A 0.5292
103 L A 1.6049
104 V A 1.2079
105 L A 1.0331
106 D A 0.4880
107 A A 0.0000
108 M A 0.0000
109 D A -0.1021
110 Y A 0.2335
111 W A -0.2290
112 G A 0.0000
113 Q A -1.2257
114 G A 0.0000
115 T A 0.4655
116 L A 1.5578
117 V A 0.0000
118 T A 0.0852
119 V A 0.0000
120 S A -1.1578
121 S A -1.4083
122 G A -1.3159
123 G A -1.0938
124 G A -1.1522
125 G A -1.1626
126 S A -1.0134
127 G A -1.1611
128 G A -1.4245
129 G A -1.4090
130 G A -1.3222
131 S A -1.0477
132 G A -1.2479
133 G A -1.2169
134 G A -1.0967
135 G A -1.1325
136 S A -0.6204
137 A A 0.2425
138 L A 1.1243
139 E A -0.4849
140 T A 0.0000
141 V A 0.8716
142 L A 0.0000
143 T A -0.7846
144 Q A 0.0000
145 S A -0.8817
146 P A -0.5032
147 G A -0.8531
148 T A -0.5757
149 L A -0.2197
150 S A -0.3460
151 L A -0.6118
152 S A -1.1209
153 P A -1.7139
154 G A -2.3471
155 E A -2.7007
156 R A -3.0314
157 A A 0.0000
158 T A -0.6077
159 L A 0.0000
160 S A -0.9238
161 C A 0.0000
162 R A -2.3419
163 A A 0.0000
164 S A -0.9723
165 Q A -1.6532
166 S A -1.3549
167 L A 0.0000
168 G A -0.6359
169 S A -0.3636
170 S A 0.1655
171 Y A 0.4325
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3352
179 P A -0.9378
180 G A -1.4014
181 Q A -2.0584
182 A A -1.3396
183 P A 0.0000
184 R A -1.5079
185 L A 0.0000
186 L A 0.0000
187 I A 0.0000
188 Y A -0.0765
189 G A -0.1581
190 A A 0.0000
191 S A -0.7628
192 S A -0.8473
193 R A -1.7924
194 A A 0.0000
195 P A -0.8447
196 G A -1.0215
197 I A 0.0000
198 P A -1.3912
199 D A -2.4318
200 R A -2.0142
201 F A 0.0000
202 S A -0.9627
203 G A 0.0000
204 S A -0.6855
205 G A -1.1276
206 S A -1.1109
207 G A -1.2342
208 T A -1.7355
209 D A -2.1477
210 F A 0.0000
211 T A -0.7800
212 L A 0.0000
213 T A -0.7810
214 I A 0.0000
215 S A -2.3949
216 R A -3.4830
217 L A 0.0000
218 E A -2.4830
219 P A -1.5276
220 E A -2.3377
221 D A 0.0000
222 F A 0.0000
223 A A 0.0000
224 V A -0.2291
225 Y A 0.0000
226 Y A 0.0000
227 C A 0.0000
228 Q A 0.0000
229 Q A 0.0000
230 Y A -0.0819
231 A A -0.6617
232 D A -1.9182
233 S A -1.1605
234 P A -0.9247
235 I A 0.0000
236 T A 0.0000
237 F A 0.0899
238 G A 0.0000
239 Q A -1.3874
240 G A 0.0000
241 T A 0.0000
242 R A -0.8341
243 L A 0.0000
244 E A -0.3751
245 I A 0.7090
246 K A -0.9407
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018