Project name: e76d8a721e08687 [mutate: IH48A]

Status: done

Started: 2026-07-20 16:08:38
Settings
Chain sequence(s) A: MSSGNILWGSQNPIVFKNSFGVSNADTGSQDDLSQQNPFAEGYGVLLILLMVIQAIANNKFIEVQKNAERARNTQEKSNEMDEVIAKAAKGDAKTKEEVPEDVIKYMRDNGILIDGMTIDDYMAKYGDHGKLDKGGLQAIKAALDNDANRNTDLMSQGQITIQKMSQELNAVLTQLTGLISKWGEISSMIAQKTYS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues IH48A
Energy difference between WT (input) and mutated protein (by FoldX) 0.518377 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:01:46)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:59)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:43)
Show buried residues

Minimal score value
-3.909
Maximal score value
2.0148
Average score
-1.1904
Total score value
-233.3183

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8309
2 S A -0.1014
3 S A -0.6729
4 G A -0.7229
5 N A -0.8025
6 I A 0.5720
7 L A 1.3218
8 W A 0.6399
9 G A -0.1616
10 S A -1.0557
11 Q A -1.9789
12 N A -1.6194
13 P A -0.1478
14 I A 1.2011
15 V A 2.0148
16 F A 1.0143
17 K A -1.0236
18 N A -1.1497
19 S A -0.6133
20 F A 0.1842
21 G A 0.3128
22 V A 1.3178
23 S A -0.4807
24 N A -1.7131
25 A A -1.5619
26 D A -2.4883
27 T A -1.7214
28 G A -1.7444
29 S A -1.8561
30 Q A -2.9984
31 D A -3.2381
32 D A -2.6271
33 L A -0.5852
34 S A -1.3616
35 Q A -2.6746
36 Q A -2.2581
37 N A 0.0000
38 P A -1.1265
39 F A -0.3138
40 A A -0.9129
41 E A -1.7710
42 G A -0.4697
43 Y A 0.0740
44 G A -0.0799
45 V A 1.1915
46 L A 0.8224
47 L A 0.0000
48 H A 0.4142 mutated: IH48A
49 L A 0.9281
50 L A 0.0000
51 M A 1.3829
52 V A 1.2468
53 I A 0.0000
54 Q A 0.1753
55 A A 0.3216
56 I A 0.7115
57 A A 0.0000
58 N A -0.2423
59 N A -0.7451
60 K A -0.9657
61 F A 0.1095
62 I A 0.2112
63 E A -1.7535
64 V A 0.0000
65 Q A -2.1113
66 K A -2.7554
67 N A -2.4402
68 A A 0.0000
69 E A -3.7323
70 R A -3.2017
71 A A 0.0000
72 R A -3.7590
73 N A -2.9608
74 T A 0.0000
75 Q A -3.9090
76 E A -3.9024
77 K A -3.1410
78 S A 0.0000
79 N A -3.7751
80 E A -3.5884
81 M A 0.0000
82 D A -3.4298
83 E A -3.4469
84 V A 0.0000
85 I A -2.9045
86 A A -2.3044
87 K A -3.2489
88 A A 0.0000
89 A A -2.5353
90 K A -2.6949
91 G A -2.9243
92 D A -3.1407
93 A A -2.4300
94 K A -2.9506
95 T A -2.8796
96 K A -3.3059
97 E A -3.1570
98 E A -3.4232
99 V A 0.0000
100 P A -2.4966
101 E A -3.0284
102 D A -2.8956
103 V A 0.0000
104 I A -2.3845
105 K A -3.6397
106 Y A -2.5637
107 M A 0.0000
108 R A -3.2744
109 D A -3.1707
110 N A -1.9852
111 G A -1.5048
112 I A 0.0000
113 L A -0.2288
114 I A 0.0000
115 D A -1.6710
116 G A -1.0254
117 M A -1.0908
118 T A -1.1735
119 I A 0.0000
120 D A -2.4355
121 D A -2.1914
122 Y A 0.0000
123 M A -1.5567
124 A A -1.7842
125 K A -1.9713
126 Y A -0.7171
127 G A -2.2039
128 D A -2.9174
129 H A -2.5058
130 G A -2.5071
131 K A -2.9944
132 L A 0.0000
133 D A -3.0023
134 K A -2.9651
135 G A -1.7013
136 G A 0.0000
137 L A 0.0000
138 Q A -1.6936
139 A A -1.0013
140 I A 0.0000
141 K A -1.6022
142 A A -0.9199
143 A A -0.8516
144 L A 0.0000
145 D A -2.1904
146 N A -2.0710
147 D A -2.0599
148 A A 0.0000
149 N A -3.0867
150 R A -2.9718
151 N A 0.0000
152 T A -2.0357
153 D A -2.0096
154 L A -0.6980
155 M A -1.4144
156 S A -0.6505
157 Q A -0.6917
158 G A -0.8310
159 Q A -1.0317
160 I A 0.4177
161 T A -0.5605
162 I A -1.1681
163 Q A -2.1650
164 K A -2.8661
165 M A 0.0000
166 S A -2.2440
167 Q A -3.2219
168 E A -3.0470
169 L A 0.0000
170 N A -2.2199
171 A A -1.4618
172 V A 0.0000
173 L A -0.2885
174 T A -0.4745
175 Q A -0.5503
176 L A 0.0000
177 T A 0.1242
178 G A -0.2419
179 L A 0.0177
180 I A 0.5576
181 S A -0.7267
182 K A -1.4263
183 W A -0.4645
184 G A -0.8626
185 E A -1.6964
186 I A -0.3982
187 S A -0.0221
188 S A -0.8051
189 M A -0.1633
190 I A 0.3133
191 A A -0.4473
192 Q A -1.1233
193 K A -1.4980
194 T A -0.3494
195 Y A 0.4209
196 S A -0.4863
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018