Project name: query_structure

Status: done

Started: 2026-03-16 23:59:01
Settings
Chain sequence(s) A: MAQVQLVESGGGLVQAGASMRLSCAASGITFSLYHWVWFRQAAGREHEFVAGIIRSGGETLSADSVKDRFIISRDDAKNTLYLQMNMLQPEDTATYYCAATHRADWYSSAFREYIFRGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)
Show buried residues

Minimal score value
-3.4324
Maximal score value
1.1302
Average score
-0.7379
Total score value
-92.9784

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8861
2 A A -0.0035
3 Q A -0.8519
4 V A -0.1592
5 Q A -0.7828
6 L A 0.0000
7 V A 0.6901
8 E A 0.0000
9 S A -0.5500
10 G A -1.2081
11 G A -0.9694
12 G A 0.0444
13 L A 1.0107
14 V A 0.1244
15 Q A -0.9707
16 A A -0.9472
17 G A -0.6297
18 A A -0.4725
19 S A -0.8118
20 M A 0.0000
21 R A -2.0419
22 L A 0.0000
23 S A -0.4463
24 C A 0.0000
25 A A -0.2218
26 A A 0.0000
27 S A -0.3736
28 G A -0.1825
29 I A 0.2728
30 T A 0.1924
31 F A 0.0000
32 S A -0.5247
33 L A 0.4613
34 Y A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 W A 0.0000
39 F A -0.4547
40 R A -1.2926
41 Q A -2.0256
42 A A -1.9393
43 A A -1.0780
44 G A -1.8536
45 R A -3.3263
46 E A -3.4324
47 H A -2.4874
48 E A -1.8498
49 F A 0.0000
50 V A 0.0000
51 A A 0.0000
52 G A 0.0000
53 I A 0.0000
54 I A -1.3882
55 R A -2.3499
56 S A -1.4182
57 G A -1.8745
58 G A -1.7754
59 E A -2.1951
60 T A -0.4905
61 L A 0.3500
62 S A -0.5717
63 A A -1.4107
64 D A -2.6587
65 S A -1.9780
66 V A 0.0000
67 K A -3.0309
68 D A -2.6517
69 R A -1.2534
70 F A 0.0000
71 I A 0.4617
72 I A 0.0000
73 S A -0.3940
74 R A -1.4053
75 D A -2.0156
76 D A -2.4211
77 A A -1.7800
78 K A -2.5847
79 N A -2.1325
80 T A -1.2683
81 L A 0.0000
82 Y A -0.3839
83 L A 0.0000
84 Q A -0.6296
85 M A 0.0000
86 N A -0.5364
87 M A -0.0098
88 L A 0.0000
89 Q A -1.4552
90 P A -1.6825
91 E A -2.1846
92 D A 0.0000
93 T A -0.9291
94 A A 0.0000
95 T A -0.9266
96 Y A 0.0000
97 Y A -0.6097
98 C A 0.0000
99 A A 0.0000
100 A A 0.0000
101 T A 0.0000
102 H A -1.6421
103 R A -2.4415
104 A A -1.2648
105 D A -0.6581
106 W A 0.0000
107 Y A 1.1302
108 S A 0.2595
109 S A -0.3223
110 A A -0.5184
111 F A -1.3117
112 R A -2.4088
113 E A -2.4134
114 Y A -0.9696
115 I A 0.4084
116 F A 0.2496
117 R A -1.0343
118 G A -0.8095
119 Q A -1.2529
120 G A 0.0000
121 T A 0.0000
122 Q A -1.2432
123 V A 0.0000
124 T A -0.3033
125 V A 0.0000
126 S A -0.6430
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018