Project name: obj1 [mutate: ER1C, VN5C, SR7C, QH13C, LK18C, AL24C, FI29C, SP35C, KY43C, AT50C, SP54C, DM62C, FL68C, RG72C, YE80C, EC89C, CD96C, DA101C, DC108C, VR116C, SN120C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	YE80C,SP54C,FL68C,AL24C,KY43C,RG72C,DM62C,FI29C,AT50C,SN120C,SP35C,LK18C,DC108C,EC89C,QH13C,VR116C,ER1C,SR7C,DA101C,VN5C,CD96C
Energy difference between WT (input) and mutated protein (by FoldX)	41.0621 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:06:30)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:07:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:05)

• Minimal score value: -2.8036
• Maximal score value: 1.5596
• Average score: -0.5838
• Total score value: -70.059

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	R	C	-1.9793	mutated: ER1C
2	V	C	-0.8973
3	Q	C	-1.8291
4	L	C	0.0000
5	N	C	-2.0478	mutated: VN5C
6	E	C	0.0000
7	R	C	-2.6452	mutated: SR7C
8	G	C	-1.8569
9	G	C	-0.5426
10	G	C	0.6361
11	L	C	1.3948
12	V	C	-0.2210
13	H	C	-1.3727	mutated: QH13C
14	P	C	-1.6836
15	G	C	-1.3682
16	G	C	-1.0115
17	S	C	-1.4708
18	K	C	-1.5948	mutated: LK18C
19	R	C	-2.8036
20	L	C	0.0000
21	S	C	-1.7908
22	C	C	0.0000
23	A	C	-1.3417
24	L	C	0.0000	mutated: AL24C
25	S	C	-0.5217
26	D	C	0.0000
27	F	C	1.5467
28	T	C	0.2251
29	I	C	0.0000	mutated: FI29C
30	R	C	-2.1491
31	S	C	-0.9090
32	Y	C	-0.8647
33	E	C	-0.8189
34	M	C	0.0000
35	P	C	0.0000	mutated: SP35C
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	0.4000
40	A	C	0.4349
41	P	C	-0.0733
42	G	C	0.0113
43	Y	C	0.8533	mutated: KY43C
44	G	C	0.3356
45	L	C	0.9459
46	E	C	0.0081
47	W	C	0.3595
48	V	C	0.0000
49	S	C	0.0000
50	T	C	0.0000	mutated: AT50C
51	I	C	0.0000
52	S	C	-0.6386
53	G	C	-1.3241
54	P	C	-1.3692	mutated: SP54C
55	G	C	-1.2311
56	G	C	-0.7926
57	S	C	-0.3243
58	T	C	0.1815
59	Y	C	0.8991
60	Y	C	0.3305
61	A	C	0.2173
62	M	C	0.4709	mutated: DM62C
63	S	C	-0.1154
64	V	C	0.0000
65	K	C	-1.4527
66	G	C	-1.2456
67	R	C	0.0000
68	L	C	0.0000	mutated: FL68C
69	T	C	-0.7178
70	I	C	0.0000
71	S	C	-0.9067
72	G	C	-1.8494	mutated: RG72C
73	D	C	-2.2355
74	N	C	-2.5491
75	S	C	-1.9422
76	K	C	-2.4104
77	N	C	-1.7666
78	T	C	-1.7370
79	L	C	0.0000
80	E	C	-1.5588	mutated: YE80C
81	L	C	0.0000
82	Q	C	-1.4079
83	M	C	0.0000
84	N	C	-1.4484
85	S	C	-1.3165
86	L	C	0.0000
87	R	C	-2.0750
88	A	C	-1.1346
89	C	C	-0.0346	mutated: EC89C
90	D	C	0.0000
91	T	C	0.2307
92	A	C	0.0000
93	I	C	0.9998
94	Y	C	0.0000
95	Y	C	0.3262
96	D	C	0.0000	mutated: CD96C
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-2.0364
101	A	C	-1.4132	mutated: DA101C
102	G	C	-1.2317
103	F	C	-0.8512
104	N	C	-2.1156
105	K	C	-2.5883
106	G	C	-1.3956
107	F	C	-0.2749
108	C	C	-0.1075	mutated: DC108C
109	Y	C	0.0665
110	W	C	0.3306
111	G	C	-0.8324
112	Q	C	-1.6346
113	G	C	-0.5520
114	T	C	-0.1299
115	L	C	1.5596
116	R	C	0.0000	mutated: VR116C
117	T	C	0.5186
118	V	C	0.0000
119	S	C	-1.0093
120	N	C	-1.7913	mutated: SN120C