Project name: query_structure

Status: done

Started: 2026-03-16 23:08:27
Settings
Chain sequence(s) A: ESCVFIPCISSIVGCSCKSKVCYKNGSIPCG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:55)
Show buried residues

Minimal score value
-1.8647
Maximal score value
3.1268
Average score
0.3518
Total score value
10.9047

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -0.2432
2 S A 0.2576
3 C A 0.9623
4 V A 1.3775
5 F A 2.6940
6 I A 2.6265
7 P A 1.6774
8 C A 0.0000
9 I A 2.7676
10 S A 1.9184
11 S A 1.8275
12 I A 3.1268
13 V A 2.6799
14 G A 0.7207
15 C A 0.0000
16 S A -0.3180
17 C A -0.4979
18 K A -1.8647
19 S A -1.3161
20 K A -1.2278
21 V A -0.7480
22 C A 0.0000
23 Y A -0.8524
24 K A -1.0407
25 N A -1.6613
26 G A -1.2447
27 S A -0.5277
28 I A 0.4257
29 P A -0.2096
30 C A 0.1263
31 G A -0.5314
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018