Project name: 7ab60b9641c2e50

Chain sequence(s)	A: CPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:14)

• Minimal score value: -3.6005
• Maximal score value: 1.229
• Average score: -1.028
• Total score value: -44.2041

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	C	A	0.7269
2	P	A	0.3156
3	V	A	0.9573
4	L	A	0.1345
5	L	A	0.0524
6	K	A	-1.8042
7	S	A	-1.4538
8	T	A	-1.5021
9	E	A	-2.2132
10	T	A	-1.6651
11	G	A	-1.6193
12	Q	A	-2.3950
13	Y	A	0.0000
14	L	A	-0.0837
15	R	A	-0.5275
16	I	A	0.2477
17	N	A	-0.6743
18	P	A	-1.1716
19	D	A	-1.9022
20	G	A	-1.0530
21	T	A	-0.1301
22	V	A	1.1182
23	D	A	-0.0420
24	G	A	-0.9742
25	T	A	-2.3332
26	R	A	-3.5317
27	D	A	-3.6005
28	R	A	-3.4611
29	S	A	-2.1749
30	D	A	-2.0962
31	P	A	-1.3656
32	H	A	-1.0213
33	I	A	0.0000
34	Q	A	-0.8821
35	F	A	0.1886
36	Q	A	-0.0366
37	I	A	1.2290
38	S	A	-0.1611
39	P	A	-1.1948
40	E	A	-2.3060
41	G	A	-2.1643
42	N	A	-2.1511
43	G	A	-1.4825