Project name: query_structure

Chain sequence(s)	A: EVQLQASGGGLVQAGGSLRLSCTASLRAFSTYTMGWFRQAPGKEREFVAASNWRGTDFHDSVKGRFIISRDNTKKTVDLQMNSLKPEDTAIYYCAADGSTWLKRSDYSYWGQGTQVTVS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:03)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:07)

• Minimal score value: -3.5491
• Maximal score value: 1.0515
• Average score: -0.8182
• Total score value: -97.3649

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9410
2	V	A	-1.1950
3	Q	A	-1.6503
4	L	A	0.0000
5	Q	A	-1.7744
6	A	A	-1.3126
7	S	A	-1.3473
8	G	A	-1.0643
9	G	A	-0.7899
10	G	A	-0.0538
11	L	A	1.0515
12	V	A	0.0734
13	Q	A	-1.1604
14	A	A	-1.3269
15	G	A	-1.2399
16	G	A	-0.8030
17	S	A	-1.0798
18	L	A	-0.9154
19	R	A	-1.9488
20	L	A	0.0000
21	S	A	-1.1327
22	C	A	0.0000
23	T	A	-1.2604
24	A	A	0.0000
25	S	A	-1.6341
26	L	A	0.0000
27	R	A	-1.9104
28	A	A	-1.1300
29	F	A	0.0000
30	S	A	-0.5703
31	T	A	-0.2179
32	Y	A	0.1001
33	T	A	0.0000
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	-1.3570
39	Q	A	-2.0554
40	A	A	-1.9519
41	P	A	-1.3742
42	G	A	-1.9345
43	K	A	-3.3393
44	E	A	-3.5491
45	R	A	-2.7649
46	E	A	-2.4240
47	F	A	0.0000
48	V	A	0.0000
49	A	A	0.0000
50	A	A	0.0000
51	S	A	0.0000
52	N	A	0.0000
53	W	A	0.2832
54	R	A	-1.1206
55	G	A	-0.6131
56	T	A	-0.2148
57	D	A	-0.8314
58	F	A	-0.9998
59	H	A	-1.8285
60	D	A	-2.5327
61	S	A	-1.7885
62	V	A	0.0000
63	K	A	-2.4181
64	G	A	-1.4392
65	R	A	-0.8759
66	F	A	0.0000
67	I	A	0.7788
68	I	A	0.0000
69	S	A	-0.2209
70	R	A	-1.1568
71	D	A	-1.7880
72	N	A	-1.7466
73	T	A	-1.6326
74	K	A	-2.4245
75	K	A	-2.1482
76	T	A	0.0000
77	V	A	0.0000
78	D	A	-0.8552
79	L	A	0.0000
80	Q	A	-0.5253
81	M	A	0.0000
82	N	A	-0.8674
83	S	A	-1.0607
84	L	A	0.0000
85	K	A	-2.0837
86	P	A	-1.8513
87	E	A	-2.2952
88	D	A	0.0000
89	T	A	-0.8857
90	A	A	0.0000
91	I	A	-0.4043
92	Y	A	0.0000
93	Y	A	-0.6081
94	C	A	0.0000
95	A	A	0.0000
96	A	A	0.0000
97	D	A	0.0000
98	G	A	-0.2975
99	S	A	0.0426
100	T	A	0.2967
101	W	A	0.7315
102	L	A	-0.0007
103	K	A	-1.5189
104	R	A	-2.3826
105	S	A	-2.2723
106	D	A	-2.3578
107	Y	A	0.0000
108	S	A	-0.4149
109	Y	A	0.1725
110	W	A	0.0982
111	G	A	-0.8584
112	Q	A	-1.4668
113	G	A	-0.9964
114	T	A	-1.0787
115	Q	A	-0.9795
116	V	A	0.0000
117	T	A	-0.2265
118	V	A	0.0000
119	S	A	-0.7164