Project name: query_structure

Status: done

Started: 2026-03-16 20:07:35
Settings
Chain sequence(s) A: EAMHSFCAFKADDGPCRAAHPRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:39)
Show buried residues

Minimal score value
-3.3994
Maximal score value
1.6285
Average score
-1.2078
Total score value
-72.4667

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.2009
2 A A -1.0070
3 M A -0.6186
4 H A -0.3571
5 S A 0.2311
6 F A 0.4785
7 C A 0.0000
8 A A 0.6185
9 F A 0.2980
10 K A -1.4763
11 A A -1.6260
12 D A -2.1536
13 D A -2.3089
14 G A -1.8113
15 P A -1.3436
16 C A -1.2240
17 R A -1.7770
18 A A -0.8511
19 A A -0.3262
20 H A -0.6308
21 P A -0.6575
22 R A -1.3109
23 W A -1.6644
24 F A -1.1612
25 F A 0.0000
26 N A -0.4093
27 I A 0.9293
28 F A 1.6285
29 T A -0.1671
30 R A -1.4973
31 Q A -2.0122
32 C A -1.9380
33 E A -1.7321
34 E A -1.9206
35 F A -0.5105
36 I A 0.4207
37 Y A 0.0000
38 G A 0.0000
39 G A -0.9393
40 C A -1.2558
41 E A -2.3511
42 G A -2.3999
43 N A -1.7121
44 Q A -1.6099
45 N A 0.0000
46 R A -1.7350
47 F A 0.0000
48 E A -2.6401
49 S A -2.3101
50 L A -2.1575
51 E A -3.1736
52 E A -2.9853
53 C A 0.0000
54 K A -3.3994
55 K A -3.3789
56 M A -1.6210
57 C A 0.0000
58 T A -2.7557
59 R A -3.0103
60 D A -2.9428
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018