Project name: 7b48aa9cebe4a7a

Status: done

Started: 2026-06-26 14:21:10
Settings
Chain sequence(s) A: MSHHHHHHSGKIKEFMRTFVGMSDNPFSEQMEEIITAGDQAVVNMDKFWDEFRRFHHEMYWHDPELPWIVVYEVRDVLKKFKPQAQQGSFNAEAFFTEMISVFKGNPEWVEKLHDWHFNHTFHRKFRDAKKNDPEEAKDVLKRAMAMFEVHVEITGKVPKWFERFMGDFLDHFDEEEIAQVINS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:09:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:06)
Show buried residues

Minimal score value
-4.5125
Maximal score value
1.6078
Average score
-1.3823
Total score value
-254.3383

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5497
2 S A -0.6172
3 H A -1.7414
4 H A -2.3306
5 H A -2.7388
6 H A -2.7656
7 H A -2.5405
8 H A -2.4739
9 S A -2.1687
10 G A -2.3819
11 K A -3.0454
12 I A -1.9840
13 K A -2.8588
14 E A -3.4833
15 F A 0.0000
16 M A 0.0000
17 R A -3.1466
18 T A -1.9850
19 F A 0.0000
20 V A 0.0000
21 G A -1.8823
22 M A 0.0000
23 S A -1.5953
24 D A -2.7029
25 N A -2.4857
26 P A -1.9365
27 F A 0.0000
28 S A 0.0000
29 E A -2.6662
30 Q A 0.0000
31 M A 0.0000
32 E A -2.3773
33 E A -1.7724
34 I A 0.0000
35 I A 0.0000
36 T A -1.2696
37 A A -0.9095
38 G A -1.4708
39 D A -2.1293
40 Q A -1.7589
41 A A 0.0000
42 V A 0.5539
43 V A 0.0000
44 N A -2.3644
45 M A 0.0000
46 D A -3.4702
47 K A -3.1371
48 F A 0.0000
49 W A -2.6797
50 D A -3.1712
51 E A -2.7268
52 F A 0.0000
53 R A -3.2027
54 R A -3.2421
55 F A -1.8178
56 H A 0.0000
57 H A -1.7416
58 E A -1.5175
59 M A 0.0000
60 Y A -0.5129
61 W A 0.1333
62 H A -0.9938
63 D A -1.2945
64 P A -1.1065
65 E A -2.1627
66 L A 0.0000
67 P A -0.2957
68 W A 1.0183
69 I A 1.6078
70 V A 0.0000
71 V A 0.0000
72 Y A 0.5814
73 E A -0.7390
74 V A 0.0000
75 R A -2.0878
76 D A -2.8375
77 V A 0.0000
78 L A 0.0000
79 K A -3.9268
80 K A -3.4007
81 F A 0.0000
82 K A -3.4913
83 P A -2.3431
84 Q A -2.3641
85 A A -2.2042
86 Q A -2.3385
87 Q A -2.3828
88 G A -1.8203
89 S A -1.7865
90 F A 0.0000
91 N A -1.6392
92 A A 0.0000
93 E A -1.4757
94 A A -0.7355
95 F A 0.0000
96 F A 0.0000
97 T A -0.3094
98 E A -0.6432
99 M A 0.0000
100 I A -0.3980
101 S A -0.9296
102 V A 0.0000
103 F A 0.0000
104 K A -2.2057
105 G A -1.4772
106 N A 0.0000
107 P A -2.1999
108 E A -2.7210
109 W A 0.0000
110 V A 0.0000
111 E A -2.0873
112 K A -1.9447
113 L A 0.0000
114 H A 0.0000
115 D A -1.1068
116 W A -0.7128
117 H A 0.0000
118 F A 0.0000
119 N A -1.1812
120 H A -1.5159
121 T A 0.0000
122 F A 0.0000
123 H A -2.2825
124 R A -3.3181
125 K A -3.2845
126 F A 0.0000
127 R A -3.6369
128 D A -4.5125
129 A A 0.0000
130 K A -3.8630
131 K A -3.8111
132 N A -3.9193
133 D A -4.0009
134 P A -3.6687
135 E A -3.9269
136 E A -4.3798
137 A A 0.0000
138 K A -3.0062
139 D A -3.4042
140 V A 0.0000
141 L A 0.0000
142 K A -2.1708
143 R A -2.1781
144 A A 0.0000
145 M A -0.5292
146 A A -0.8902
147 M A 0.0000
148 F A -0.7092
149 E A -2.0366
150 V A 0.0000
151 H A 0.0000
152 V A -1.2361
153 E A -2.4289
154 I A 0.0000
155 T A 0.0000
156 G A -1.5892
157 K A -1.6953
158 V A -0.1489
159 P A 0.0000
160 K A -2.3699
161 W A 0.0000
162 F A -1.3780
163 E A -2.8324
164 R A -3.1001
165 F A 0.0000
166 M A -1.1140
167 G A -1.7221
168 D A -1.9004
169 F A 0.0000
170 L A -0.5747
171 D A -1.9722
172 H A -2.2614
173 F A 0.0000
174 D A -3.3889
175 E A -3.6112
176 E A -3.6660
177 E A -3.0138
178 I A -1.8650
179 A A -1.8526
180 Q A -2.2572
181 V A 0.0000
182 I A 0.1959
183 N A -1.0257
184 S A -0.7846
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018