Project name: 7b5c9f18ddfe442

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFTFRSFAIGWFRQAPGKGLEGVSSIGTSGSPTYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAVLPGPLSGGDTYVSYYEYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:43)

• Minimal score value: -2.9599
• Maximal score value: 1.562
• Average score: -0.5883
• Total score value: -73.5321

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.0900
2	V	A	-1.3200
3	Q	A	-1.5018
4	L	A	0.0000
5	V	A	0.3974
6	E	A	0.0000
7	S	A	-0.2460
8	G	A	-0.5375
9	G	A	0.2599
10	G	A	0.7317
11	L	A	1.3089
12	V	A	0.0000
13	Q	A	-1.5042
14	P	A	-1.8648
15	G	A	-1.6054
16	G	A	-1.1007
17	S	A	-1.1634
18	L	A	-0.8304
19	R	A	-1.7699
20	L	A	0.0000
21	S	A	-0.4697
22	C	A	0.0000
23	A	A	-0.4762
24	A	A	0.0000
25	S	A	-1.0477
26	G	A	-1.2541
27	F	A	-0.6608
28	T	A	-0.6374
29	F	A	0.0000
30	R	A	-2.1729
31	S	A	-0.9748
32	F	A	-0.2355
33	A	A	0.0000
34	I	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	0.0000
39	Q	A	-1.2149
40	A	A	-1.3959
41	P	A	-1.3349
42	G	A	-1.5799
43	K	A	-2.5069
44	G	A	-1.8011
45	L	A	-0.9809
46	E	A	-1.3104
47	G	A	-0.2170
48	V	A	0.0000
49	S	A	0.0000
50	S	A	0.0000
51	I	A	0.0000
52	G	A	0.0000
53	T	A	-0.8571
54	S	A	-0.9544
55	G	A	-0.8839
56	S	A	-0.4421
57	P	A	-0.3915
58	T	A	-0.1325
59	Y	A	-0.3436
60	Y	A	-0.8621
61	A	A	-1.4762
62	D	A	-2.5322
63	S	A	-1.8284
64	V	A	0.0000
65	K	A	-2.6283
66	G	A	-1.8170
67	R	A	-1.7717
68	F	A	0.0000
69	T	A	-0.8685
70	I	A	0.0000
71	S	A	-0.4963
72	R	A	-1.3531
73	D	A	-1.9580
74	N	A	-2.1262
75	A	A	-1.6488
76	K	A	-2.3385
77	N	A	-2.1971
78	T	A	-1.3284
79	L	A	0.0000
80	Y	A	0.0000
81	L	A	0.0000
82	Q	A	-1.2262
83	M	A	0.0000
84	N	A	-1.4394
85	S	A	-1.4522
86	L	A	0.0000
87	R	A	-2.9599
88	A	A	-2.0647
89	E	A	-2.4976
90	D	A	0.0000
91	T	A	-0.5652
92	A	A	0.0000
93	V	A	0.7270
94	Y	A	0.0000
95	Y	A	0.2031
96	C	A	0.0000
97	A	A	0.0000
98	V	A	0.0000
99	L	A	0.0000
100	P	A	-0.2483
101	G	A	-0.2354
102	P	A	-0.2838
103	L	A	-0.0676
104	S	A	-0.4956
105	G	A	-0.6151
106	G	A	-0.1523
107	D	A	0.3295
108	T	A	0.6322
109	Y	A	1.5620
110	V	A	1.1143
111	S	A	0.8335
112	Y	A	1.2936
113	Y	A	0.0000
114	E	A	-1.1664
115	Y	A	-0.5605
116	W	A	-0.1023
117	G	A	-0.2713
118	Q	A	-0.8415
119	G	A	-0.0148
120	T	A	0.5272
121	L	A	1.5271
122	V	A	0.0000
123	T	A	0.2426
124	V	A	0.0000
125	S	A	-0.9210