Project name: Mb5-11_VVLFVF

Status: done

Started: 2026-07-06 06:36:28
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTFTVYAVTWYPRYGYGESGPVSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:06)
Show buried residues

Minimal score value
-2.798
Maximal score value
1.5181
Average score
-0.7606
Total score value
-82.9098

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2116
2 Q A -1.0048
3 A A 0.0000
4 N A -1.9708
5 S A -1.5179
6 G A 0.0000
7 S A -1.2552
8 L A -0.9902
9 E A -1.7114
10 V A -0.3836
11 V A 0.3214
12 E A -1.2877
13 A A -1.1226
14 S A -1.3112
15 P A -1.9958
16 T A -1.2848
17 S A -1.1688
18 L A 0.0000
19 Q A -0.7252
20 V A 0.0000
21 S A -1.0317
22 W A 0.0000
23 D A -2.4839
24 A A -1.5952
25 F A 0.0000
26 H A -1.2595
27 R A 0.0000
28 Y A 0.9402
29 H A 0.2929
30 N A -0.5683
31 G A 0.1356
32 F A 1.5181
33 T A 0.7713
34 H A 0.1252
35 P A -0.3890
36 V A -1.0678
37 R A -1.6233
38 Y A -1.1694
39 Y A 0.0000
40 R A -1.1849
41 V A 0.0000
42 T A -0.6618
43 Y A -0.3279
44 G A -0.6974
45 E A -1.6089
46 T A -1.2594
47 G A -1.2229
48 G A -1.3716
49 N A -1.5323
50 S A -0.8924
51 P A -0.3823
52 V A 0.3371
53 Q A -1.0475
54 E A -1.7665
55 F A -0.7084
56 T A -0.3142
57 V A -0.5524
58 P A -1.0964
59 G A -1.3987
60 S A -1.3159
61 K A -2.0246
62 S A -1.2848
63 T A -0.8071
64 A A 0.0000
65 T A -0.3078
66 L A 0.0000
67 S A -0.7688
68 G A -0.9992
69 L A 0.0000
70 K A -2.5562
71 P A -2.2091
72 G A -1.6139
73 V A -1.4513
74 D A -2.3041
75 Y A 0.0000
76 T A -0.7388
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.5012
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.7294
85 Y A 0.0000
86 P A -0.3910
87 R A -1.0768
88 Y A 0.7422
89 G A 0.7113
90 Y A 1.1000
91 G A 0.4621
92 E A -1.0559
93 S A 0.0000
94 G A -1.0303
95 P A -0.5963
96 V A -0.1488
97 S A -0.3387
98 F A -0.2663
99 N A -1.5857
100 Y A -1.6501
101 R A -2.7253
102 T A 0.0000
103 E A -2.6093
104 L A -1.3646
105 D A -2.7637
106 K A -2.7980
107 P A -1.7828
108 S A -1.6376
109 Q A -1.6602
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018