Project name: 7b81f619b34fdf1

Status: done

Started: 2026-07-08 16:39:04
Settings
Chain sequence(s) A: EQAALIAEAERIAARVRANMAEAEAVIREGDAASQAHLPAFRAQAAELDALTAELLAALRAEDWEAAAATLRRLLAAGEEYIAIMEKAKVPQELIDRARQIRAEGERLLEKLAAAVAAHS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:04)
Show buried residues

Minimal score value
-3.5317
Maximal score value
0.0
Average score
-1.5015
Total score value
-180.1746

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.2086
2 Q A -1.9110
3 A A -1.1476
4 A A -0.9768
5 L A -1.5781
6 I A -1.6037
7 A A -1.5509
8 E A -2.4665
9 A A 0.0000
10 E A -2.8544
11 R A -3.1123
12 I A -1.8826
13 A A -1.6393
14 A A -1.4823
15 R A -1.3581
16 V A -1.0670
17 R A -0.8614
18 A A -0.7171
19 N A 0.0000
20 M A 0.0000
21 A A -0.7985
22 E A -1.5675
23 A A 0.0000
24 E A -1.6835
25 A A -1.3744
26 V A -1.5335
27 I A 0.0000
28 R A -3.1991
29 E A -3.2099
30 G A -2.9324
31 D A -2.9712
32 A A -1.6867
33 A A -1.3419
34 S A 0.0000
35 Q A -2.6265
36 A A -1.1988
37 H A -1.4475
38 L A -1.1413
39 P A -0.9589
40 A A -0.6307
41 F A 0.0000
42 R A -2.0999
43 A A -1.3591
44 Q A -1.5947
45 A A 0.0000
46 A A -1.5360
47 E A -1.9579
48 L A 0.0000
49 D A -1.9748
50 A A -1.4606
51 L A 0.0000
52 T A -1.4798
53 A A -1.2189
54 E A -1.8423
55 L A 0.0000
56 L A -1.1364
57 A A -1.4124
58 A A -1.9947
59 L A 0.0000
60 R A -2.4683
61 A A -2.0268
62 E A -3.2431
63 D A -2.8829
64 W A 0.0000
65 E A -2.3759
66 A A -1.8309
67 A A 0.0000
68 A A -1.7841
69 A A -1.4746
70 T A -1.7867
71 L A 0.0000
72 R A -2.8124
73 R A -2.6344
74 L A -2.4249
75 L A 0.0000
76 A A -2.0525
77 A A 0.0000
78 G A -2.1625
79 E A -2.6968
80 E A -2.5317
81 Y A 0.0000
82 I A -1.8770
83 A A -1.8413
84 I A -1.6083
85 M A 0.0000
86 E A -2.7560
87 K A -2.7065
88 A A 0.0000
89 K A -3.1090
90 V A 0.0000
91 P A -2.0009
92 Q A -3.1288
93 E A -3.2384
94 L A 0.0000
95 I A 0.0000
96 D A -3.4931
97 R A -2.7053
98 A A 0.0000
99 R A -2.7574
100 Q A -2.4664
101 I A 0.0000
102 R A -2.1304
103 A A -1.8822
104 E A -2.1714
105 G A 0.0000
106 E A -3.3253
107 R A -3.5317
108 L A 0.0000
109 L A -2.6208
110 E A -3.3857
111 K A -3.0259
112 L A 0.0000
113 A A -1.3340
114 A A -0.8808
115 A A -1.5006
116 V A -1.1629
117 A A -0.4533
118 A A -0.3128
119 H A -1.2294
120 S A -0.5630
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018