Project name: mScarlet3

Status: done

Started: 2026-07-15 15:58:55
Settings
Chain sequence(s) A: AVIKEFMRFKVHMEGSSMNGHEFEIIEGEGEGRPYEGTQTAKLRVTKGGPLPFSWDILSPQFAAASRAFTKHPADIPDYWKQSFPPEGFKWERVVMNFEEDGGAVSVAQDTSSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDVVLKGDIKMALRLKDGGRYLADFKTTYRAKKPVQMPGAFNIDRKLLDIITSSHNEDYTVVEQYYEERSVARHS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:48)
Show buried residues

Minimal score value
-3.3156
Maximal score value
0.2367
Average score
-1.0457
Total score value
-223.7847

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 A A -0.1786
8 V A 0.2367
9 I A 0.0000
10 K A -2.3150
11 E A -2.5666
12 F A -1.6387
13 M A 0.0000
14 R A -3.0309
15 F A 0.0000
16 K A -2.9701
17 V A 0.0000
18 H A -2.1841
19 M A 0.0000
20 E A -3.2035
21 G A 0.0000
22 S A 0.0000
23 M A 0.0000
24 N A -1.8821
25 G A -1.8358
26 H A -1.9091
27 E A -3.1485
28 F A 0.0000
29 E A -2.6649
30 I A 0.0000
31 E A -2.3873
32 G A 0.0000
33 E A -2.7385
34 G A 0.0000
35 E A -2.4012
36 G A 0.0000
37 R A -2.8732
38 P A 0.0000
39 Y A -1.4587
40 E A -2.5157
41 G A 0.0000
42 T A -1.4490
43 Q A 0.0000
44 T A -1.1807
45 A A 0.0000
46 K A -1.6808
47 L A 0.0000
48 R A -1.2021
49 V A -0.9346
50 T A -1.5565
51 K A -2.7841
52 G A -1.9512
53 G A -1.5998
54 P A -1.0792
55 L A 0.0000
56 P A -0.8698
57 F A 0.0000
58 S A 0.0000
59 W A 0.0000
60 D A 0.0000
61 I A 0.0000
62 L A 0.0000
63 S A 0.0000
64 P A -0.0328
65 Q A 0.0000
66 F A 0.0000
70 S A -0.0216
71 R A 0.0000
72 A A 0.0000
73 F A 0.0000
74 T A 0.0000
75 K A -1.5684
76 H A -1.1211
77 P A -1.0633
78 A A -1.0152
79 D A -2.1141
80 I A 0.0000
81 P A -1.0048
82 D A -0.8543
83 Y A 0.0000
84 W A 0.0000
85 K A -0.3320
86 Q A -0.6772
87 S A 0.0000
88 F A 0.0000
89 P A -0.9322
90 E A -1.7224
91 G A 0.0000
92 F A 0.0000
93 K A -2.0473
94 W A 0.0000
95 E A -1.6273
96 R A 0.0000
97 V A -0.7859
98 M A 0.0000
99 N A -1.8705
100 F A 0.0000
101 E A -2.6008
102 D A -2.1183
103 G A -1.7487
104 G A 0.0000
105 A A -1.4394
106 V A 0.0000
107 S A -1.2392
108 V A 0.0000
109 A A -1.5321
110 Q A 0.0000
111 D A -1.7662
112 T A 0.0000
113 S A -1.0406
114 L A -1.1050
115 E A -2.5324
116 D A -2.6692
117 G A -2.0863
118 T A -2.2747
119 L A 0.0000
120 I A -1.5275
121 Y A 0.0000
122 K A -2.4276
123 V A 0.0000
124 K A -2.9802
125 L A 0.0000
126 R A -2.8046
127 G A 0.0000
128 T A -1.5495
129 N A -1.7468
130 F A 0.0000
131 P A -1.5459
132 P A -1.6426
133 D A -2.4585
134 G A -1.7453
135 P A -2.0088
136 V A 0.0000
137 M A -1.5565
138 Q A -2.4590
139 K A -2.2347
140 K A -2.6869
141 T A 0.0000
142 M A -1.0992
143 G A -0.7122
144 W A 0.0000
145 E A -1.3668
146 A A -0.9027
147 S A -1.1238
148 T A -1.3418
149 E A 0.0000
150 R A -2.6516
151 L A 0.0000
152 Y A -0.9708
153 P A -0.8742
154 E A -1.9518
155 D A -1.5729
156 V A 0.1387
157 V A -0.5664
158 L A 0.0000
159 K A -1.6987
160 G A 0.0000
161 D A -2.2986
162 I A 0.0000
163 K A -2.7018
164 M A 0.0000
165 A A 0.0000
166 L A 0.0000
167 R A -2.6343
168 L A -2.7593
169 K A -3.3156
170 D A -3.2565
171 G A -2.6240
172 G A -2.4784
173 R A -2.8708
174 Y A 0.0000
175 L A -1.7766
176 A A 0.0000
177 D A -2.8532
178 F A 0.0000
179 K A -2.6262
180 T A 0.0000
181 T A 0.0000
182 Y A 0.0000
183 R A -1.4059
184 A A -1.1136
185 K A -1.5978
186 K A -1.1394
187 P A -0.4887
188 V A -0.4158
189 Q A -0.9162
190 M A -0.4794
191 P A 0.0000
192 G A -0.9540
193 A A -0.9590
194 F A 0.0000
195 N A -1.5816
196 I A 0.0000
197 D A -1.4080
198 R A -1.2484
199 K A -1.5089
200 L A -0.9771
201 D A -1.2633
202 I A -0.4927
203 T A -0.6360
204 S A -0.9937
205 H A -1.5672
206 N A -1.7348
207 E A -2.4974
208 D A -1.9295
209 Y A -1.0528
210 T A -0.8016
211 V A -0.5421
212 V A 0.0000
213 E A -1.3194
214 Q A 0.0000
215 Y A -0.5157
216 E A -0.9466
217 R A -2.1254
218 S A 0.0000
219 V A -0.9737
220 A A 0.0000
221 R A -1.7689
222 H A -1.9981
223 S A -1.2712
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018