Project name: 7c4412786a10f62

Chain sequence(s)	A: GEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLVSRHWKRGFILKRGEPPPGKPADDAGLV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:05)

• Minimal score value: -3.7075
• Maximal score value: 2.239
• Average score: -1.3094
• Total score value: -161.0621

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-1.4619
2	E	A	-2.2744
3	P	A	-1.5362
4	P	A	-1.4596
5	P	A	-1.4250
6	G	A	-1.5942
7	K	A	-2.4315
8	P	A	-2.3490
9	A	A	-2.3183
10	D	A	-3.1077
11	D	A	-2.4746
12	A	A	-1.0745
13	G	A	-0.0599
14	L	A	1.1825
15	V	A	1.7619
16	S	A	0.0738
17	R	A	-1.8476
18	H	A	-1.9620
19	W	A	-1.0763
20	K	A	-2.7510
21	R	A	-3.0580
22	G	A	-1.0519
23	F	A	1.5033
24	I	A	0.0000
25	L	A	0.5698
26	K	A	0.0000
27	R	A	-2.7253
28	G	A	-2.7061
29	E	A	-2.9200
30	P	A	-2.2513
31	P	A	-1.1342
32	P	A	-1.2493
33	G	A	-1.2295
34	K	A	-1.5720
35	P	A	-1.8345
36	A	A	0.0000
37	D	A	-3.1987
38	D	A	0.0000
39	A	A	-1.4295
40	G	A	-0.1052
41	L	A	0.0000
42	V	A	1.3204
43	S	A	0.0000
44	R	A	-1.6279
45	H	A	0.0000
46	W	A	-1.5851
47	K	A	-3.3692
48	R	A	-3.4489
49	G	A	0.0000
50	F	A	1.1284
51	I	A	0.0000
52	L	A	0.4340
53	K	A	0.0000
54	R	A	-2.6541
55	G	A	-2.8449
56	E	A	-3.1520
57	P	A	-2.5201
58	P	A	-1.5497
59	P	A	-1.2238
60	G	A	-1.4452
61	K	A	-1.8389
62	P	A	-2.0805
63	A	A	0.0000
64	D	A	-3.2278
65	D	A	-2.3724
66	A	A	-1.3845
67	G	A	-0.4788
68	L	A	0.0000
69	V	A	0.6799
70	S	A	0.0000
71	R	A	-1.4068
72	H	A	0.0000
73	W	A	-1.6106
74	K	A	-3.5215
75	R	A	-2.8068
76	G	A	0.0000
77	F	A	0.9453
78	I	A	0.0000
79	L	A	0.0680
80	K	A	0.0000
81	R	A	-3.5133
82	G	A	-3.3831
83	E	A	-3.7075
84	P	A	-2.6540
85	P	A	0.0000
86	P	A	-1.3273
87	G	A	-1.5218
88	K	A	-1.7454
89	P	A	-1.8941
90	A	A	-2.3246
91	D	A	-2.9443
92	D	A	-2.4082
93	A	A	-1.3042
94	G	A	-0.1403
95	L	A	0.0000
96	V	A	1.1288
97	S	A	0.0000
98	R	A	-1.6570
99	H	A	-1.8883
100	W	A	-1.4379
101	K	A	-3.3961
102	R	A	-2.7455
103	G	A	-1.4495
104	F	A	1.2043
105	I	A	1.4741
106	L	A	0.3893
107	K	A	-1.6676
108	R	A	-3.4164
109	G	A	-3.4789
110	E	A	-3.5827
111	P	A	-2.6921
112	P	A	-2.0098
113	P	A	-1.3962
114	G	A	-1.5589
115	K	A	-2.6753
116	P	A	-2.1908
117	A	A	-2.6046
118	D	A	-3.1098
119	D	A	-2.5813
120	A	A	-1.3013
121	G	A	0.2005
122	L	A	2.1614
123	V	A	2.2390