Project name: Mb5-11_I18L_I104L_LLLVVF_Lib2_Lib3_overlap

Status: done

Started: 2026-07-07 23:12:14
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRLTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTVTVYAVTWYPRYGYGESGPVSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:03)
Show buried residues

Minimal score value
-2.6984
Maximal score value
1.4783
Average score
-0.6932
Total score value
-75.559

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2127
2 Q A -1.0548
3 A A 0.0000
4 N A -1.9747
5 S A -1.5693
6 G A 0.0000
7 S A -1.2849
8 L A 0.0000
9 E A -1.7253
10 V A -0.6639
11 V A 0.3601
12 E A -1.4060
13 A A -1.0523
14 S A -1.4680
15 P A -1.6799
16 T A -1.1075
17 S A -1.3439
18 L A 0.0000
19 Q A -0.8982
20 L A 0.0000
21 S A -1.0704
22 W A 0.0000
23 D A -2.4189
24 A A -1.5445
25 F A 0.0000
26 H A -1.2214
27 R A 0.0000
28 Y A 0.9133
29 H A 0.2398
30 N A -0.5937
31 G A 0.1290
32 F A 1.4783
33 T A 0.7054
34 H A 0.0259
35 P A -0.4367
36 V A -1.0476
37 R A -1.5803
38 Y A -0.9258
39 Y A 0.0000
40 R A -0.8629
41 L A 0.0000
42 T A -0.6749
43 Y A -0.2516
44 G A -0.5822
45 E A -1.2948
46 T A -0.9757
47 G A -1.1271
48 G A -1.2525
49 N A -1.4652
50 S A -0.7984
51 P A -0.3555
52 V A 0.3279
53 Q A -1.1943
54 E A -1.8259
55 F A -0.7205
56 T A -0.2094
57 V A -0.4368
58 P A -0.9652
59 G A -1.2548
60 S A -1.2197
61 K A -1.8497
62 S A -1.2036
63 T A -0.8436
64 A A 0.0000
65 T A -0.3648
66 L A 0.0000
67 S A -0.7738
68 G A -0.9645
69 L A 0.0000
70 K A -2.2310
71 P A -1.8558
72 G A -1.1295
73 V A -1.0113
74 D A -2.0010
75 Y A 0.0000
76 T A -0.4926
77 V A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.4408
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5641
85 Y A 0.0000
86 P A -0.4430
87 R A -1.1040
88 Y A 0.7092
89 G A 0.6819
90 Y A 1.0035
91 G A 0.3252
92 E A -0.7391
93 S A 0.0000
94 G A -1.0694
95 P A -0.5876
96 V A 0.0000
97 S A -0.1316
98 F A 0.2498
99 N A -1.3549
100 Y A -1.5601
101 R A -2.4719
102 T A 0.0000
103 E A -2.0434
104 L A -0.9439
105 D A -2.5503
106 K A -2.6984
107 P A -1.7901
108 S A -1.6392
109 Q A -1.6608
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018