Project name: 7cb63a2e58c833d

Status: done

Started: 2026-03-18 15:57:10
Settings
Chain sequence(s) A: GSEEESDKDIWELVQAYMDDMAAIDWETITLEEFEALKKEWLERFDKLIEEFKKRGDERGVKDANWWKNFFEGNFEIQAEEIREREK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:31)
Show buried residues

Minimal score value
-5.3452
Maximal score value
0.4567
Average score
-2.3559
Total score value
-204.9627

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -2.3854
2 S A -3.2170
3 E A -4.9218
4 E A -5.0564
5 E A -4.9468
6 S A 0.0000
7 D A -5.3452
8 K A -4.8796
9 D A -4.2020
10 I A 0.0000
11 W A -2.1414
12 E A -2.9222
13 L A 0.0000
14 V A 0.0000
15 Q A -1.6272
16 A A -1.4078
17 Y A 0.0000
18 M A -0.9449
19 D A -2.0068
20 D A -1.4079
21 M A -0.7775
22 A A -0.7399
23 A A -0.8164
24 I A -1.0691
25 D A -1.9623
26 W A -1.4998
27 E A -2.3927
28 T A -1.4388
29 I A -1.2849
30 T A -2.2404
31 L A -2.8613
32 E A -3.1139
33 E A -3.2225
34 F A 0.0000
35 E A -3.7113
36 A A -2.8769
37 L A -2.4893
38 K A -3.2865
39 K A -3.7482
40 E A -3.5806
41 W A 0.0000
42 L A -2.7853
43 E A -3.5319
44 R A -3.2256
45 F A 0.0000
46 D A -3.5891
47 K A -3.9133
48 L A -3.1123
49 I A 0.0000
50 E A -4.6681
51 E A -4.2414
52 F A 0.0000
53 K A -5.2437
54 K A -4.6387
55 R A -4.3118
56 G A -3.6939
57 D A -4.1697
58 E A -4.5513
59 R A -4.5655
60 G A 0.0000
61 V A -3.6123
62 K A -3.5280
63 D A -3.0421
64 A A 0.0000
65 N A -1.4944
66 W A -0.1606
67 W A -0.1184
68 K A -1.2333
69 N A -0.8484
70 F A 0.4567
71 F A 0.0000
72 E A -1.4607
73 G A -0.8385
74 N A -0.5392
75 F A 0.0000
76 E A -2.2542
77 I A -0.2906
78 Q A -1.6178
79 A A -2.9356
80 E A -3.9269
81 E A -4.0131
82 I A 0.0000
83 R A -5.0394
84 E A -5.1192
85 R A -4.2552
86 E A -4.6227
87 K A -3.7025
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018